Recombinant Rat Procathepsin L (Ctsl), partial

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Ctsl
Uniprot NO.
Alternative Names
Ctsl; Ctsl1Cathepsin L1; EC 3.4.22.15; Cathepsin L; Cyclic protein 2; CP-2; Major excreted protein; MEP) [Cleaved into: Procathepsin L; Cathepsin L1 heavy chain; Cathepsin L1 light chain]
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
114-288aa
Target Protein Sequence
IPKTVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Thiol protease important for the overall degradation of proteins in lysosomes. Plays a critical for normal cellular functions such as general protein turnover, antigen processing and bone remodeling. Involved in the solubilization of cross-linked TG/thyroglobulin and in the subsequent release of thyroid hormone thyroxine (T4) by limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen. In neuroendocrine chromaffin cells secretory vesicles, catalyzes the prohormone proenkephalin processing to the active enkephalin peptide neurotransmitter. In thymus, regulates CD4(+) T cell positive selection by generating the major histocompatibility complex class II (MHCII) bound peptide ligands presented by cortical thymic epithelial cells. Also mediates invariant chain processing in cortical thymic epithelial cells. Major elastin-degrading enzyme at neutral pH. Accumulates as a mature and active enzyme in the extracellular space of antigen presenting cells (APCs) to regulate degradation of the extracellular matrix in the course of inflammation. Secreted form generates endostatin from COL18A1. Critical for cardiac morphology and function. Plays an important role in hair follicle morphogenesis and cycling, as well as epidermal differentiation. Required for maximal stimulation of steroidogenesis by TIMP1.
Gene References into Functions
  1. the activation of cathepsin L contributes to the irreversible depolarization produced by oxygen and glucose deprivation PMID:27818353
  2. Cathepsins in Rotator Cuff Tendinopathy: Identification in Human Chronic Tears and Temporal Induction in a Rat Model. PMID:25558848
  3. Inhibition of the activation of cathepsin L contributes to neuroprotection against cerebral ischemia. PMID:24616078
  4. Changes in olfaction were less consistent and widespread in the hippocampus, but were again sex specific for three genes: cathepsin-L (CtsL), matrix metalloproteinase-14 (MMP-14) and MMP-16. PMID:23103411
  5. With aging, the level of cathepsin L delined at 18 month but rose at 24 month in brain. PMID:21374014
  6. double transgenic rats (human renin and angiotensinogen genes) were used to investigate sex differences influencing renal function and gene expression. Cathepsin L was differentially expressed between the sexes and associated with degree of renal injury. PMID:21357272
  7. confirmed 6-hydroxydopamine induced nuclear translocation of cathepsin L in rat substantia nigral neurons as well PMID:21134415
  8. study found, in differentiated PC12 cells, lysosomal membrane permeabilization is an early event in palmitic acid-induced lipotoxicity preceeding mitochondrial membrane permeabilization & apoptosis; cathepsin L is an important contributor in this process PMID:20043885
  9. shows evolution in placental expression PMID:12054558
  10. the GC-box is a critical regulatory element for the cathepsin L promoter in mature Sertoli cells PMID:12606333
  11. data document that three Sp1/specificity protein 3 binding regions and a functional cyclic amp regulatory element constitute an important transcriptional regulatory complex for expression of the cathepsin L gene in rat granulosa cells PMID:14563703
  12. The induction of puromycin aminonucleoside nephrosis involves podocyte migration conducted by a coordinated interplay between the cysteine protease cathepsin L and alpha(3) integrin PMID:15197181
  13. endothelial cell-associated cathepsins B and L are not involved in the invasive growth of capillaries from existing blood vessels and the presence of collagen is necessary for MMP2 expression in endothelial cells PMID:15255544
  14. The co-localization of PAP/TRAP and the cysteine protease cathepsin L could suggest a role for cathepsin L in the in vivo proteolytic processing of PAP/TRAP. PMID:15761664
  15. Results show Cathepsin L plays a critical role in the lysosomal degradation of L-lactate dehydrogenase. PMID:16960372
  16. Our data strongly suggests that the decrease in heat shock protein levels and the significant reduction of serum albumin leakage into the brain following acute treatment with CP-1 is indicative of less secondary ischemic damage. PMID:18060871
  17. Study indicates that CTSL improves cardiac function and inhibits cardiac hypertrophy, inflammation, and fibrosis through blocking Akt/GSK3beta signaling. PMID:19096818
  18. Upstream repressors and activators as well as cis-acting elements near the transcription start site control stage-specific Ctsl transcription by Sertoli cells. PMID:19458314

Show More

Hide All

Subcellular Location
Lysosome. Apical cell membrane; Peripheral membrane protein; Extracellular side. Cytoplasmic vesicle, secretory vesicle, chromaffin granule. Secreted, extracellular space. Secreted.
Protein Families
Peptidase C1 family
Tissue Specificity
Both mature cathepsin L1 and procathepsin L are found in the upper epidermis. The lower epidermis predominantly contains procathepsin L. In seminiferous tubules expression is greater at stages VI-VII than at stages IX-XII.
Database Links

UNIGENE: Rn.1294

KEGG: rno:25697

STRING: 10116.ENSRNOP00000025462

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1