Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
BdnfBrain-derived neurotrophic factor; BDNF) [Cleaved into: BDNF precursor form; ProBDNF)]
Species
Rattus norvegicus (Rat)
Expression Region
136-243aa
Target Protein Sequence
RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 136-243 form the expressed segment for recombinant Rat Bdnf. This Bdnf protein is expected to have a theoretical molecular weight of 16.3 kDa. This Bdnf recombinant protein is manufactured in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of Bdnf, making it easier to detect and purify the Bdnf recombinant protein in the later stages of expression and purification.
The rat brain-derived neurotrophic factor (BDNF), a member of the neurotrophin family, is crucial for the development, survival, and function of neurons in the nervous system. BDNF is widely expressed in the brain and peripheral tissues, influencing neuronal processes such as synaptic plasticity, neurogenesis, and cell survival. BDNF binds to its receptor, TrkB, initiating intracellular signaling pathways that impact neuronal growth and function. Research on rat BDNF is extensive and encompasses neurodevelopmental processes, learning and memory, and its involvement in various neurological disorders. Understanding BDNF's role provides insights into the molecular mechanisms underlying neural function and potential therapeutic strategies for neurodegenerative conditions.