Abbreviation
Recombinant Rat Asgr1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Rat Asgr1 at 2 μg/mL can bind Anti-ASGR1 recombinant antibody (CSB-RA002207MA3HU). The EC50 is 2.336-2.712 ng/mL. ②ASGR1 Recombinant Monoclonal Antibody (CSB-RA002207MA3HU) captured on Protein A Chip can bind Recombinant Rat Asgr1 with an affinity constant of 0.12 nM as detected by MetaSPR Assay (WeSPRTM 200).
Research Area
Signal Transduction
Alternative Names
Asialoglycoprotein receptor 1; ASGP-R 1; ASGPR 1; Hepatic lectin 1; HL-1; rHL-1
Species
Rattus norvegicus (Rat)
Expression Region
61-284aa
Target Protein Sequence
QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Asgr1 at 2 μg/ml can bind Anti-ASGR1 recombinant antibody (CSB-RA002207MA3HU). The EC50 is 2.336-2.712 ng/mL.
-
Activity
ASGR1 Recombinant Monoclonal Antibody (CSB-RA002207MA3HU) captured on Protein A Chip can bind Recombinant Rat Asgr1 with an affinity constant of 0.12 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
Asialoglycoprotein receptor 1 mediates the endocytosis of desialylated glycoproteins in hepatocytes, a pathway central to glycoprotein clearance and targeted drug delivery to the liver. This partial construct spanning residues 61–284 encompasses the carbohydrate recognition domain and demonstrates robust conformational integrity, binding an anti-ASGR1 recombinant antibody with a sub-nanomolar affinity constant of 0.12 nM as measured by MetaSPR and an EC50 of 2.336–2.712 ng/mL in functional ELISA. Mammalian expression ensures native post-translational modifications critical for lectin activity, supporting use in ligand-binding assays, competitive inhibition screens for glycan-targeted therapeutics, and therapeutic antibody epitope mapping where authentic receptor conformation is essential. The protein meets quality thresholds commonly required for SPR and BLI affinity characterization, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg.
