Recombinant Rabbit Type-1 angiotensin II receptor (AGTR1), partial

Product Details

Purity
>85% (SDS-PAGE)
Target Names
AGTR1
Uniprot NO.
Alternative Names
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1
Species
Oryctolagus cuniculus (Rabbit)
Source
Yeast
Expression Region
297-359
Target Protein Sequence
LNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCF EVE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Ang II increase HTFs proliferation, migration, and phenotype transition, suggesting that Ang II may play a role in wound healing after trabeculectomy. PMID:25564450
  2. Renal AT1R expression was increased by approximately 67% and AT2R expression was decreased by approximately 87% in rabbits with heart failure; however, kidneys from denervated rabbits with heart failure showed a near normalization in the expression of these receptors. PMID:20962112
  3. Atrial fibrillation induces myocardial fibrosis through angiotensin II type 1 receptor-specific Arkadia-mediated downregulation of Smad7. PMID:21127293
  4. Following inflammation in the femoral artery angiotensin AT1 receptors are activated along with thromboxane receptors. PMID:20202467
  5. Corneal cells express ACE, AT(1) and AT(2)receptors. ACE inhibitor enalapril decreased corneal angiogenesis in VEGF-induced corneal neovascularization. ACE inhibitors may be novel therapy to treat corneal angiogenesis. PMID:20431722
  6. Ascorbic acid decreases the binding affinity of the AT(1) receptor. PMID:18091746
  7. investigated whether oxidant stress plays a role in Ang II-induced AT1R upregulation and its relationship to the transcription factor activator protein 1 (AP1) in CHF rabbits and in the CATHa neuronal cell line PMID:18566341

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1