Abbreviation
Recombinant Rabbit TFPI protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC50 is 2.281-3.783 ng/mL.
Alternative Names
(TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)
Molecular Characterization
Species
Oryctolagus cuniculus (Rabbit)
Expression Region
25-300aa
Target Protein Sequence
AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/ml can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC50 is 2.281-3.783 ng/mL.
Description
Tissue factor pathway inhibitor serves as a critical regulator of the extrinsic coagulation cascade, making it a key target in cardiovascular and thrombosis research. This recombinant rabbit TFPI, spanning the full mature sequence (aa 25–300) with an N-terminal 10×His tag positioned away from the functional Kunitz domains, demonstrated robust binding activity in a functional ELISA, with an EC50 of 2.281–3.783 ng/mL against an anti-TFPI recombinant antibody when immobilized at 1 μg/mL. These validated binding data support use in inhibitor screening and IC50 determination, enzymatic activity assays, substrate specificity profiling, and as a positive control in enzyme-linked assay formats. Mammalian-expressed to preserve native post-translational modifications, this protein meets the quality thresholds commonly required for kinetic parameter analysis and drug candidate evaluation, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg to minimize assay interference.
