Recombinant Rabbit Superoxide dismutase [Cu-Zn] (SOD1)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
SOD1
Uniprot NO.
Alternative Names
SOD1; Superoxide dismutase [Cu-Zn]; EC 1.15.1.1
Species
Oryctolagus cuniculus (Rabbit)
Source
Yeast
Expression Region
2-153
Target Protein Sequence
ATKAVCVLKGDGPVEATIHFEQKGTGPVVVKGRITGLTEGLHEFHVHQFGDNRQGCTSAG PHFNPLSKKHGGPKDEERHVGDLGNVTAGSNGVADVLIEDSVISLSGDMSVIGRTLVVHE KEDDLGKGGNDESTKTGNAGSRLACGVIGISP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Gene References into Functions
  1. amyloid and oxidative stress-related disease proteins like SOD 1 is increased in expression and form localized accumulations in diabetic muscle in this rabbit model of diabetes. PMID:20819221

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Cu-Zn superoxide dismutase family
Database Links

UNIGENE: Ocu.2588

KEGG: ocu:100009313

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1