Home
Product
Protein
Recombinant Proteins
Recombinant Plasmodium falciparum Merozoite surface protein 2 (MSP2), partial

Recombinant Plasmodium falciparum Merozoite surface protein 2 (MSP2), partial

Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

MSP2

Uniprot NO.

P50498

Research Area

Others

Alternative Names

MSA2; PFB0300c; Merozoite surface antigen 2; MSA-2; 45 kDa merozoite surface antigen

Species

Plasmodium falciparum (isolate 3D7)

Source

Baculovirus

Expression Region

109-246aa

Target Protein Sequence

NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Partial

Tag Info

N-terminal His-tagged and C-terminal Myc-tagged/N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May play a role in the merozoite attachment to the erythrocyte.

Gene References into Functions

Genetic polymorphism of Merozoite Surface Protein-2 (MSP-2) in Plasmodium falciparum isolates from Pawe District, North West Ethiopia PMID:28542247
msp2 genetic profiles iof solates collected from successive malaria episodes in ten children who had four or more clinical episodes during follow up PMID:23217196
MSP2 Antigenic differences characterized via epitope mapping; results show that there are significant conformational differences between the two forms of MSP2 PMID:22966050
Allele typing of the msp2 gene detected 55% and 45% of 3D7 and FC27 allelic families in Plasmodium falciparum field isolates from Congolese children with asymptomatic infections. PMID:22463364
The majority of patients from all the five sites had mean monoclonal infections of 67.1 and 60.4% of P. falciparum for msp-1 and msp-2, respectively, whereas, mean multiple genotypes of 32.8 and 39.5% for msp-1 and msp-2, respectively. PMID:22325817
the helical structure of the N-terminal region of Plasmodium falciparum merozoite surface protein 2 has a role in fibril formation and membrane interaction PMID:22304430
Field isolates are highly diverse in respect of MSP2 and multiplicity of infection was neither age nor parasite density dependent in the study population. PMID:21809706
We tested the hypothesis that sequence diversity in MSP2 renders parasites bearing heterologous MSP2 alleles differentially susceptible to Fc-dependent functions of allele-specific MSP2 antibodies PMID:21189324
roles of individual residues in fibril formation and local ordered structure in two peptides, a recombinant 25-residue peptide corresponding to the entire N-terminal domain of mature MSP2 and an 8-residue peptide from the central region of this domain PMID:20542076
Extensive genetic polymorphism with diverse allele types was identified in MSP-1 and MSP-2 in P. falciparum field isolates from Myanmar. PMID:20478015
reports the functional properties of polyclonal and monoclonal antibodies induced by site-directed designed MSP-2 N-terminus pseudopeptides and their capacity for antibody isotype switching in in vitro immunization PMID:17881088
The two major complications seen in the subjects, cerebral malaria and severe anaemia, were each found to be significantly associated with the 3D7 subtype of msp-2 PMID:18577328
analysis of selective pressures on the merozoite surface protein 2 locus of Plasmodium falciparum PMID:18840512
current and comprehensive information on the diversity in the gene that encodes the merozoite surface protein (MSP) 1 and 2 and its implications on the epidemiology of malaria, immunity and development of control measures [review] PMID:19326702
MSP2 oligomers containing intermolecular beta-strand interactions similar to those in amyloid fibrils. PMID:19450733