Recombinant Pig Vimentin (VIM)

Code
MSDS
Size Pls inquire
Source
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
VIM
Uniprot NO.
Species
Sus scrofa (Pig)
Source
Yeast
Expression Region
1-275
Target Protein Sequence
STRTVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLSTSSPGGVG YYATRSSAVRLRSSVPGVRLLQDAVDFSLADAINTEFKWYKSKFADLSEAANRNNDALRQ AKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQN MKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLESL PLVDTHSKRTLLIKTVETRDGQVINETSQHHNDLE
Protein Length
Full length protein
Tag Info
N-terminal His-tagged/Tag-Free
Storage
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Vimentins are class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is attached to the nucleus, endoplasmic reticulum, and mitochondria, either laterally or terminally.; Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.
Gene References into Functions
  1. ANXA2 can interact with vimentin and enhance porcine reproductive and respiratory syndrome virus (PRRSV) growth. This contributes to the regulation of PRRSV replication in infected cells and may have implications for the future antiviral strategies. PMID:30053894
  2. As the inner cell mass forms the epiblast, SSEA1 is lost and VIMENTIN is lost and re-expressed. PMID:20865782
  3. These observations indicate that vimentin serves as a putative receptor for Japanese encephalitis virus in porcine kidney cells. PMID:21798293
  4. Interaction of nucleocapsid protein of transmissible gastroenteritis virus with host vimentin is required for virus infection. PMID:25533531
  5. protein(s) that associated with RPTPbeta in response to IGF-I and IGFBP-2 in vascular smooth muscle cells PMID:25787077
  6. This study demonstrates that maternal VIM, as a genomic protector, is crucial for nuclear reprogramming in porcine cloned embryos. PMID:24474691

Show More

Hide All

Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Nucleus matrix. Cell membrane.
Protein Families
Intermediate filament family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1