Recombinant Pig Transcription factor A, mitochondrial (TFAM)

Product Details

Abbreviation
TFAM
Purity
>85% (SDS-PAGE)
Target Names
TFAM
Uniprot NO.
Alternative Names
TFAM; Transcription factor A; mitochondrial; mtTFA
Species
Sus scrofa (Pig)
Source
Yeast
Expression Region
43-246
Target Protein Sequence
SSTLSGFPKKPMTSYVRFSKEQLPIFKAQNPDAKNSELIKKIAELWRELPDSEKKIYEDA YRADWQVYKEEVNRIQEQLTPSQMVSLEKEIMQKRLKKKALIKKRELTMLGKPKRPRSAY NIFIAERFQEAKDGPSQVKLKTINENWKNLSSSQKQVYIQLAEDDKVRYYNEMKSWEEQM VEVGRNDLIRRSMKHSAKKDTEEC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Component of the mitochondrial transcription initiation complex, composed at least of TFB2M, TFAM and POLRMT that is required for basal transcription of mitochondrial DNA. In this complex, TFAM recruits POLRMT to a specific promoter whereas TFB2M induces structural changes in POLRMT to enable promoter opening and trapping of the DNA non-template strand. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA.
Gene References into Functions
  1. TFAM may exert a critical role in porcine gametogenesis and preimplantation embryo development. PMID:18636550

Show More

Hide All

Subcellular Location
Mitochondrion. Mitochondrion matrix, mitochondrion nucleoid.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1