Recombinant Pig Fatty acid-binding protein, heart (FABP3)

Code: CSB-EP007943PI
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Sus scrofa (Pig)
Tag Info: N-terminal 10xHis and C-terminal myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
FABP3
Uniprot NO.
Research Area
Cardiovascular
Alternative Names
Fatty acid-binding protein 3 (Heart-type fatty acid-binding protein) (H-FABP)
Species
Sus scrofa (Pig)
Source
E.coli
Expression Region
2-133aa
Target Protein Sequence
VDAFAGTWKLVDSKNFDDYMKSIGVGFATRQVANMTKPTTIIEVNGDTIIIKTQSTFKSTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWNGQETTLVRELVDGKLILTLTHGSAVCTRTYEKEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis and C-terminal myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Gene References into Functions
  1. SNPs in the FABP3 promoter may contribute to intramuscular fat without influencing carcass fatness traits in pigs PMID:25306509
  2. Expression of the FABP3 gene enhances adipogenesis in 3T3-L1 preadipocytes primarily by upregulating lipogenic genes. PMID:24737696
  3. Results indicate that fatty acid binding protein H-FABP and CoA ligase 4 ACSL4 genes might serve as markers to improve fat (IMF) content in the breeding system. PMID:25177956
  4. hFABP rises faster and correlates better with infarct size and no-reflow than hsTnI in myocardial infarction + reperfusion when measured early after reperfusion. PMID:23873799
  5. Linkage disequilibrium analysis among MC4R, LEP and H-FABP revealed that these genes were independent. PMID:22290286
  6. The FABP3 polymorphisms can be used as genetic markers in breeding programs for intramuscular fat content as well as carcass back fat thickness. PMID:20848210
  7. The H-FABP MspI RFLP genotype affected unsaturated fatty acid content, and the ratio of polyunsaturated fatty acid to saturated fatty acid (P<0.05), whereas the H-FABP HaeIII RFLP genotype had no effect on fatty acid characteristics. PMID:20659784
  8. The objective of this study was to investigate the effect of FABP3 and LEPR genetic variations as well as their mRNA expression on the intramuscular fat content trait in a three-generation of Korean native pig and Yorkshire crossed animals. PMID:20300864
  9. Results of associated analysis show that the polymorphism of H-FABP gene was associated traits of Intramuscular fat content (IMF) and back fat thickness (BF). PMID:16520310
  10. In our study FABP3 genotypes were confirmed to be significantly associated with intramuscular fat in pigs. PMID:16706925
  11. Sirt1 regulates the expression of FABP3 gene in adipocytes, and PPAR gamma apparently plays an important role in this process. PMID:19479941

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products