Recombinant Pig Pro-opiomelanocortin (POMC), partial

Product Details

Purity
>85% (SDS-PAGE)
Target Names
POMC
Uniprot NO.
Alternative Names
POMC; Pro-opiomelanocortin; POMC; Corticotropin-lipotropin) [Cleaved into: NPP; Melanotropin gamma; Gamma-MSH); Corticotropin; Adrenocorticotropic hormone; ACTH); Melanocyte-stimulating hormone alpha; Alpha-MSH; Melanotropin alpha); Corticotropin-like intermediary peptide; CLIP); Lipotropin beta; Beta-LPH); Lipotropin gamma; Gamma-LPH); Melanocyte-stimulating hormone beta; Beta-MSH; Melanotropin beta); Beta-endorphin; Met-enkephalin]
Species
Sus scrofa (Pig)
Source
Yeast
Expression Region
27-106
Target Protein Sequence
WCLE SSQCQDLSTE SNLLACIRAC KPDLSAETPV FPGNGDAQPL TENPRKYVMG HFRWDRFGRR NGSSSGGGGG GGGAGQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

This protein is only listed on the website as 500ug,1mg, but is it possible that this protein could provide a smaller SIZE?

A:
Thanks for your inquiry. Recombinant Pig Pro-opiomelanocortin(POMC),partial
CSB-YP355615PI >> Yeast
CSB-EP355615PI >> E.coli
CSB-BP355615PI >> Baculovirus
CSB-MP355615PI >> Mammalian cell
regional representation:27-106aa; Fragment
Tag Information:N-terminal 6xHis-tagged
expressed sequences:

WCLESSQCQDLSTESNLLACIRACKPDLSAETPVFPGNGDAQPLTENPRKYVMGHFRWDRFGRRNGSSSGGGGGGGGAGQ


The smallest specification is 50ug

Target Background

Function(From Uniprot)
Stimulates the adrenal glands to release cortisol.; Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; Increases the pigmentation of skin by increasing melanin production in melanocytes.; Endogenous orexigenic opiate.; Endogenous opiate.
Gene References into Functions
  1. Porcine follicular cells (especially granulosa cells) may produce opioid peptides and that gonadotropins may modulate gene expression of their precursors in these cells. PMID:17023126
  2. The expression of the genes coding for proopiomelanocortin (POMC), proenkephalin (PENK) and prodynorphin (PDYN) in porcine luteal cells isolated from corpora lutea (CL) collected on days 3-6, 8-10 and 13-16 of the oestrous cycle is reported. PMID:18277703

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
POMC family
Tissue Specificity
ACTH and MSH are produced by the pituitary gland.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1