Home
Product
Protein
Recombinant Proteins
Recombinant Aspergillus fumigatus Ribonuclease mitogillin (mitF)

Recombinant Aspergillus fumigatus Ribonuclease mitogillin (mitF)

In Stock

Code: CSB-EP304681NGSa3

Rate （N/A）
Review （0）

Size:

20μg100μg1mg

US$388

Quantity:

Express system: E.coli

Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Tag Info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Neosartorya fumigata mitF protein

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

mitF

Uniprot NO.

P67875

Research Area

Signal Transduction

Alternative Names

mitF; aspF1; AFUA_5G02330; Ribonuclease mitogillin; EC 3.1.27.-; Allergen Asp f I; Allergen I/a; IgE-binding ribotoxin; Major allergen Asp f 1; allergen Asp f 1

Species

Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Source

E.coli

Expression Region

28-176aa

Target Protein Sequence

ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Tris-based buffer,50% glycerol

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.

Gene References into Functions

Both Deltaaspf1 and DeltagliP single mutants had reduced lethality in non-neutropenic mice, and a Deltaaspf1 DeltagliP double mutant had a greater reduction in lethality than either single mutant. PMID:30052103

Hide All

Subcellular Location

Secreted.

Protein Families

Ribonuclease U2 family

Database Links

KEGG: afm:AFUA_5G02330

Promotions