Home
Product
Protein
Recombinant Proteins
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85C (fbpC)

Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85C (fbpC)

CSB-EP363614MVZ

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$388

Quantity:

Express system: E.coli

Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Tag Info: N-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

fbpC

Uniprot NO.

P9WQN8

Research Area

Others

Alternative Names

Acyl-CoA:diacylglycerol acyltransferase Antigen 85 complex C Short name: 85C Short name: Ag85C Fibronectin-binding protein C Short name: Fbps C

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Source

E.coli

Expression Region

46-340aa

Target Protein Sequence

AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA

Mol. Weight

36.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP363614MVZ could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) fbpC.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP363614MVZ could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) fbpC.

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

I am interested in using cat # CSB-EP363614MVZ.
Would it be possible to know the concentration product when provided in liquid format?

Very nice to receive your inquiry.
We have two lots of CSB-EP363614MVZ in stock.
1. Lot03716
Delivery Form: Liquid
Protein Concentration: 0.6mg/ml
2. Lot03679
Delivery Form: Lyophilized Powder
Protein Concentration before Lyophilization: 0.8mg/ml

Target Background

Function

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM.

Subcellular Location

Secreted.

Protein Families

Mycobacterial A85 antigen family

Database Links

KEGG: mtc:MT0137

Promotions