Abbreviation
Recombinant Mouse Ror1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Ror1 at 2 μg/mL can bind Anti-ROR1 recombinant antibody (CSB-RA020067MA2HU). The EC50 is 0.8551-0.9363 ng/mL.
Alternative Names
Inactive tyrosine-protein kinase transmembrane receptor ROR1; mROR1; Neurotrophic tyrosine kinase, receptor-related 1; Ror1; Ntrkr1
Species
Mus musculus (Mouse)
Expression Region
30-403aa
Target Protein Sequence
QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Ror1 at 2 μg/ml can bind Anti-ROR1 recombinant antibody (CSB-RA020067MA2HU). The EC50 is 0.8551-0.9363 ng/mL.
Description
ROR1 serves as a promising target in oncology and developmental neuroscience, yet its pseudokinase status and complex extracellular architecture demand native post-translational modifications for faithful ligand recognition. This mammalian-expressed fragment spanning residues 30–403 captures the extracellular domain and satisfies the purity and endotoxin criteria typical for therapeutic antibody screening, with greater than 95% purity by SDS-PAGE and less than 1.0 EU/μg endotoxin. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 0.8551–0.9363 ng/mL when the protein is immobilized at 2 μg/mL, providing quantitative evidence that supports its use in competitive inhibition assays, blocking antibody screening, and epitope mapping studies. The confirmed binding activity makes this protein appropriate for SPR or BLI affinity characterization, small-molecule inhibitor screening, and as a positive control in receptor-ligand interaction platforms targeting ROR1-dependent signaling pathways.
