Home
Product
Protein
Active Protein
Other
Recombinant Mouse Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Ror1), partial (Active)

Recombinant Mouse Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Ror1), partial (Active)

CSB-MP4008MO

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$136

Quantity:

Express system: Mammalian cell

Species: Mus musculus (Mouse)

Tag Info: C-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Ror1 at 2 μg/mL can bind Anti-ROR1 recombinant antibody (CSB-RA020067MA2HU). The EC50 is 0.8551-0.9363 ng/mL.

Target Names

Ror1

Uniprot NO.

Q9Z139

Alternative Names

Inactive tyrosine-protein kinase transmembrane receptor ROR1; mROR1; Neurotrophic tyrosine kinase, receptor-related 1; Ror1; Ntrkr1

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

30-403aa

Target Protein Sequence

QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Mol. Weight

44.6 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Ror1 at 2 μg/ml can bind Anti-ROR1 recombinant antibody (CSB-RA020067MA2HU). The EC₅₀ is 0.8551-0.9363 ng/mL.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo. Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling. In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells.

Gene References into Functions

Ror1 has a critical role in regulating SC proliferation during skeletal muscle regeneration PMID:28790171
Ror1 is crucial for spiral ganglion neurons to innervate auditory hair cells. Impairment of ROR1 function largely affects development of the inner ear and hearing in humans and mice. PMID:27162350
Although Ror1-mutant mice show no apparent defects in ureteric bud (UB) formation, Ror1; Ror2-double-mutant mice exhibit either defects in UB outgrowth and branching morphogenesis, associated with the loss of the MM from the UB domain, or ectopic formation of the UB. PMID:26840931
Wnt5a-Ror1 and Wnt5a-Ror2 signaling pathways regulated neurogenesis in the developing neocortex. PMID:22328498
results identify resistin as a potential inhibitory ligand for the receptor ROR1 and demonstrate, for the first time, that ROR1 plays an important role in adipogenesis and glucose homeostasis in 3T3-L1 cells PMID:22074948
loss of the orphan receptor Ror1 results in a variety of phenotypic defects within the skeletal and urogenital systems PMID:20593419
Expression and subcellular localization of Ror tyrosine kinase receptors are developmentally regulated in cultured hippocampal neurons. PMID:12898527
The ROR1 protein suppression using antisense oligonucleotides or RNA interference (RNAi), neurons extended shorter and less branched minor processes when compared to those in control cells. PMID:15654020