Recombinant Mouse Tumor suppressor p53-binding protein 1 (Tp53bp1)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Tp53bp1
Uniprot NO.
Alternative Names
Tp53bp1; Trp53bp1; TP53-binding protein 1; 53BP1; p53-binding protein 1; p53BP1
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
1-1957
Target Protein Sequence
MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEEDAGSHFSVLSRHLPNLQMHKENPVLD IVSNPEQSAVEQGDSNSSFNEHLKEKKASDPVESSHLGTSGSISQVIERLPQPNRTSSAL AVTVEAASLPEEEKEEEELEEKEGVGANAPGADSLAAEDSASSQLGFGVLELSQSQDVEE HTVPYDVNQEHLQLVTTNSGSSPLSDVDASTAIKCEEQPTEDIAMIEQPSKDIPVTVQPG KGIHVVEEQNLPLVRSEDRPSSPQVSVAAVETKEQVPARELLEEGPQVQPSSEPEVSSTQ EDLFDQSSKTASDGCSTPSREEGGCSPVSTPATTLQLLQLSGQKPLVQESLSTNSSDLVA PSPDAFRSTPFIVPSSPTEQGGRKDEPMDMSVIPAGGEPFQKLHDDEAMETEKPLLPSQP TVSPQASTPVSRSTPVFTPGSLPIPSQPEFSHDIFIPSPSLEEPSDDVKKGGGLHSSSLT VECSKTSESEPKNFTDDLGLSMTGDSCKLMLSTSEYSQSSKMESLGSPRTEEDRENTQID DTEPLSPVSNSKLPADSENVLVTPSQDDQVEMSQNVDKAKEDETEDRGDCKGREDAVAED VCIDLTCDSGSQAVPSPATRSEALSSVLDQEEAMDTKEHHPEEGFSGSEVEEVPETPCGS HREEPKEEAMESIPLHLSLTETQSEALCLQKEAPKEECPEAMEVETSVISIDSPQKLQVL DQELEHKDPDTWEEATSEDSSVVIVDVKEPSPRADVSCEPLEEVEKCSDSQSWEGVAPEE EPCAENRLDTPEEKRIECDGDSKAETTEKDAVTEDSPQPPLPSVRDEPVRPDQETQQPQV QEKESPVTVDAEVADDKQLGPEGACQQLEKAPACASQSFCESSSETPFHFTLPKEGDIIP PLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVTSESMVEINDPLLGNEKGDSE SAPEMDGKLSLKMKLVSPETEASEESLQFSLEKPTTAERKNGSTAIAEPVASLQKPVPVF GCIYEAQQEKEAQSEAPPSAPDRANLLHFPSAQEEDKERPDVTPKLRQSEQPVKPVGPVM DDAAPEDSASPVSQQRASQEPFSPAEDVMETDLLEGLAANQDRPSKMLMDRPTQSNIGIQ TVDHSLCAPETVSAATQTVKSVCEQGTSTAEQNSGKQDATVQTERGSGEKPASAPVDDTE SLHSQGEEEFEMPQPPHGHVLHRHMRTIREVRTLVTRVITDVYYVDGTEVERKVTEETEE PIVECQECETEVSPSQTGGSSGDLGDISSFSSKASSSHHTSSGTSLSAIHSSGSSGRGAG PLKGKASGTEAADFALPSSRGGPGKLSPRKGISQTGAPVCEEDGDAGLGIRQGGKAPVTP RGRGRRGRPPSRTTGTRETVVSGPLGVEDISPSMSPDDKSFTRIMPRVPDSTKRTDASSS TLRRSDSPEIPFQAATGSSDGLDSSSSGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKY KLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKE GQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNISS PVTPTAASSSSTTPTRKATESPRASTGVPSGKRKLPTSEEERSPAKRGRKSATVKPGTVG AAEFVSPCETGDNIGEPSVLEEPRGPLPLNKTLFLGYAFLLTMATTSDKLASRSKLLDGP TGSSEEEEEFLEIPPFNKQYTECQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKY FLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVL LVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAE ALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Double-strand break (DSB) repair protein involved in response to DNA damage, telomere dynamics and class-switch recombination (CSR) during antibody genesis. Plays a key role in the repair of double-strand DNA breaks (DSBs) in response to DNA damage by promoting non-homologous end joining (NHEJ)-mediated repair of DSBs and specifically counteracting the function of the homologous recombination (HR) repair protein BRCA1. In response to DSBs, phosphorylation by ATM promotes interaction with RIF1 and dissociation from NUDT16L1/TIRR, leading to recruitment to DSBs sites. Recruited to DSBs sites by recognizing and binding histone H2A monoubiquitinated at 'Lys-15' (H2AK15Ub) and histone H4 dimethylated at 'Lys-20' (H4K20me2), two histone marks that are present at DSBs sites. Required for immunoglobulin class-switch recombination (CSR) during antibody genesis, a process that involves the generation of DNA DSBs. Participates in the repair and the orientation of the broken DNA ends during CSR. In contrast, it is not required for classic NHEJ and V(D)J recombination. Promotes NHEJ of dysfunctional telomeres.
Gene References into Functions
  1. mediates changes in chromatin architecture that affect break order. PMID:27320916
  2. this study shows that 53BP1 is required for three-dimensional organization of the immunoglobulin heavy chain locus and provides a plausible explanation for the link with 53BP1 enforcement of deletional immunoglobulin class switch recombination PMID:28159901
  3. Genomic instability can be rescued by the deletion of Trp53bp1, which encodes the DNA damage response factor 53BP1, and mice expressing RING-less BRCA1 do not show an increased susceptibility to tumors in the absence of 53BP1. PMID:27670884
  4. Unlike directly induced DSBs, secondary DSBs were not efficiently repaired, although Rad51 and 53BP1 were recruited to these sites. H2AX was dramatically stabilized in response to DSBs directly caused by gamma-rays, enabling gammaH2AX foci formation and DSB repair, whereas H2AX was barely stabilized in response to secondary DSBs, in which gammaH2AX foci were small and DSBs were not efficiently repaired PMID:27251002
  5. Study showed that mammalian cells use microtubules in the cytoplasm to promote the mobility of sites of DNA damage in the nucleus; molecular details of this process remain to be determined, the main players, including the MOB domain of 53BP1, the linker of the nucleoskeleton, and cytoskeleton complex, kinesins, and microtubules are now known, allowing further study. PMID:26544937
  6. These experiments define a novel requirement for 53BP1 in the fusions of DNA-PKcs-deficient telomeres throughout the cell cycle. PMID:25264618
  7. Study concludes that only the 53BP1 status in DNA lesions, induced by UVA or gamma-rays, is affected by A-type lamin deficiency, which was not observed for heterochromatin-related proteins HP1beta and BMI1. PMID:24611931
  8. Binding of 53BP1 to methyl K810 occurs on E2 promoter binding factor target genes and allows pRb activity to be effectively integrated with the DNA damage response. PMID:25049398
  9. study uncovers novel ATM-independent functions for 53BP1 in the suppression of oncogenic translocations and in radioprotection PMID:23858098
  10. Study concludes that 53BP1 promotes productive class switch recombination and suppresses mutagenic DNA repair through distinct phosphodependent interactions with RIF1 and PTIP. PMID:23727112
  11. Thus, RIF1 and 53BP1 cooperate to block DSB resection to promote NHEJ in G1, which is antagonized by BRCA1 in S phase to ensure a switch of DSB repair mode to homologous recombination PMID:23333305
  12. loss of 53BP1 alters the translocatome by increasing rearrangements to intergenic regions. PMID:23290917
  13. A mutant lacking the oligomerization domain (53BP1(oligo)) was only modestly impaired in promoting NHEJ of dysfunctional telomeres and showed no defect with regard to the repression of CtIP. PMID:23345425
  14. data establish Rif1 as an important contributor to the control of double-strand break repair by 53BP1 PMID:23306437
  15. deletion of 53BP1 in TRF1-deficient cells impairs the C-NHEJ repair pathway, decreasing the occurrence of chromosome-type end to end telomere fusions while inducing a persistent DNA damage signal that activates the ATR-dependent DDR and HR repair pathways PMID:22508511
  16. XLF repair protein and 53BP1 DNA damage response factor have overlapping functions in end joining and lymphocyte development PMID:22355127
  17. find that combined XLF/53BP1 deficiency in mice severely impairs C-NHEJ, V(D)J recombination, and lymphocyte development while also leading to general genomic instability and growth defects PMID:22308489
  18. Data suggest a link between recruitment of 53BP1, resolution of DNA damage, and increased species lifespan. PMID:21931182
  19. A novel pathway regulates the levels of 53BP1 & the repair of DNA DSBs by the NHEJ pathway. The central player is cathepsin L which is impacted upon by the loss of A-type lamins and can be regulated by treatment with vitamin D. PMID:21750527
  20. Roles of Dot1L and 53Bp1 in gene expression and the control of DNA double-strand repair pathways in the context of chromatin. PMID:21383990
  21. Data elucidate the molecular events that are required for 53BP1 to maintain genomic stability and point to a model wherein 53BP1 and H2AX cooperate to repress resection of DSBs PMID:21549309
  22. Loss of both 53Bp1 and Brca1 rescues the inviability of Brca1-deficient mice, without increasing tumourigenesis. PMID:20724228
  23. Data show that ATM-dependent resection at a subset of DSBs leads to ATR-dependent Chk1 activation, and that 53BP1(-/-) and MDC1(-/-) cells manifest a checkpoint defect at high radiation doses. PMID:20421415
  24. Data show that H2AX is essential for viability in a PARP1-deficient background, while deficiency for 53BP1 modestly exacerbates phenotypes of growth retardation, genomic instability, and organismal radiosensitivity observed in PARP1-deficient mice. PMID:20231360
  25. 53BP1 protein binds to Rnf8, suggesting DNA damage involves RNF8 dependent ubiquitylation, which allows its accumulation at damaged chromatin. PMID:20385748
  26. Study shows that DNA breaks in Brca1-deficient cells are aberrantly joined into complex chromosome rearrangements by a process dependent on the nonhomologous end-joining (NHEJ) factors 53BP1 and DNA ligase 4. PMID:20362325
  27. 53BP1 regulates the choice of end-joining pathways by interfering with resection, thereby favoring classical nonhomologous end joining (C-NHEJ) during class switch regulation.. PMID:20368578
  28. m53BP1(tr/tr) mice are sensitive to ionizing radiation and cells from these animals exhibit chromosomal abnormalities consistent with defects in DNA repair, indicating that 53BP1 is a critical element in the DNA damage response. PMID:12578828
  29. 53BP1 acts downstream of ATM and upstream of Chk2 in the DNA damage response pathway and is involved in tumor suppression PMID:12640136
  30. Data show that the major globular domain of the 53BP1 central region adopts a new structural motif composed of two tightly packed Tudor domains and a C-terminal alpha helix. PMID:15341721
  31. Snm1 and 53BP1 are components of a mitotic stress checkpoint that negatively targets the APC prior to chromosome condensation PMID:15542852
  32. RNA has a role in the binding of 53BP1 to chromatin damaged by ionizing radiation PMID:15840649
  33. 53BP1 at DSBs significantly lagged behind Mdc1/NBD1. PMID:16009723
  34. p53 binding protein 1 (53BP1) plays a role in stabilizing the synapsis of switch regions during immunoglobulin class switch recombination. PMID:17183606
  35. 53BP1 is dispensable for signalling apoptosis and cell-cycle arrest in the intestinal epithelium PMID:17452983
  36. Results show that 53BP1 functions in XRCC4-dependent nonhomologous end-joining, likely mediated by its interaction with dimethylated lysine 20 of histone H4, independent of H2AX. PMID:18158901
  37. MDC1 functions as an upstream regulator of 53BP1 in the DDR pathway and in tumor suppression PMID:18504301
  38. data suggest a more general role for 53BP1 in maintaining genomic stability during long-range joining of DNA breaks PMID:18931658
  39. 53BP1, which is known to be recruited to DNA damage sites, is undetectable at mitotic chromosomes and its localisation changes upon blastocyst formation from mainly nuclear to cytoplasmic. PMID:19598117
  40. Report a selective requirement for 53BP1 in the biological response to genomic instability induced by Brca1 deficiency. PMID:19716796

Show More

Hide All

Subcellular Location
Nucleus. Chromosome. Chromosome, centromere, kinetochore.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1