Recombinant Mouse Tumor necrosis factor ligand superfamily member 10 (Tnfsf10)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Tnfsf10
Uniprot NO.
Alternative Names
Tnfsf10; Trail; Tumor necrosis factor ligand superfamily member 10; TNF-related apoptosis-inducing ligand; Protein TRAIL; CD antigen CD253
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
39-291
Target Protein Sequence
YMYFTNEMKQLQDNYSKIGLACFSKTDEDFWDSTDGEILNRPCLQVKRQLYQLIEEVTLR TFQDTISTVPEKQLSTPPLPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESW ESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQ YIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDL DQEASFFGAFLIN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Extracellular domain
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
Gene References into Functions
  1. TRAIL protects against insulin resistance, NAFLD and vascular inflammation. Increasing TRAIL levels may be an attractive therapeutic strategy, to reduce features of diabetes, as well as liver and vascular injury, so commonly observed in individuals with NAFLD. PMID:28507343
  2. Isolated highly-pure population of DcR2-positive renal tubular epithelial cells was isolated by MACS, which was confirmed to comprise of active senescent RTECs based on the cell cycle phase. PMID:28461078
  3. Data suggest that the CXCL9-CXCR3 axis plays a pivotal role in the liver-specific distribution of TRAIL+ NK cells in mice. PMID:29088306
  4. this study shows pathogenic role for TRAIL in chronic obstructive pulmonary disease PMID:26555706
  5. pCLE results indicated that endomicroscopy could effectively quantify injected MSCs that homed to subcutaneous xenograft tumor sites in vivo and correlated well with the therapeutic effects of the TRAIL gene PMID:27617958
  6. the aim of this study is to elucidate the role of TRAIL during rhinovirus (RV) infection in vivo. PMID:27836899
  7. Tnfsf10 expression is increased in eosinophilic esophagitis. Tnfsf10(-/-) mice were largely protected from esophageal fibrosis and eosinophilic inflammation. PMID:27742702
  8. Diabetes significantly increased OPG and the OPG/TRAIL ratio expression in the aorta, while dyslipidemia was the major determinant of the changes observed in the heart, where it significantly increased OPG and reduced TRAIL expression, thus increasing cardiac OPG/TRAIL ratio. PMID:28070143
  9. Membrane-proximal TRAIL species are incapable of inducing short circuit apoptosis signaling: Implications for drug development and basic cytokine biology.( PMID:26935795
  10. TRAIL can promote angiogenesis following hindlimb ischemia in vivo via NOX4/eNOS/nitric oxide signaling. PMID:26572549
  11. PARP1 acts as a prominent upstream regulator of high mobility group box 1-mediated autophagy and maintains a homeostatic balance between apoptosis and autophagy, which provides new insight into the mechanism of TNFSF10 resistance PMID:25607248
  12. Data suggest that Socs3 (suppressor of cytokine signaling 3) plays critical negative role in regulation of Trail expression in endoplasmic reticulum stress in macrophages via Jun N-terminal kinase/AP-1 transcription factor signaling. PMID:25827060
  13. These findings indicate that acute fasting enhances TRAIL-mediated liver natural killer cell activity against neoplastic cells through upregulation of heat shock protein 70. PMID:25356750
  14. These results demonstrated that TRAIL plays a deleterious role in acute kidney injury pathogenesis induced by scald burns PMID:25031778
  15. TRAIL-deficiency in ApoE(-/-) mice exacerbates nephropathy and insulin resistance PMID:24667560
  16. TRAIL induces apoptosis in tissue-infiltrating neutrophils thereby protecting organs from sepsis-induced injury. PMID:24887152
  17. Tumor necrosis factor-related apoptosis-inducing ligand translates neonatal respiratory infection into chronic lung disease. PMID:24045576
  18. These results suggest that TRAIL inhibits VEGF-induced angiogenesis by increasing caspase-8 activity and subsequently decreasing non-apoptotic signaling functions of procaspase-8, without inducing caspase-3 activation and endothelial cell cytotoxicity. PMID:24097299
  19. expression of TRAIL on natural killer cells is protective in a murine model of hepatic ischemia-reperfusion injury through modulation of natural killer cell cytotoxicity and NK cell differentiation PMID:24804996
  20. TRAIL signaling and cell death in the immature central nervous system after hypoxia-ischemia and inflammation PMID:24509861
  21. The extracellular domain of Fn14 fused to the extracellular domain of the TRAIL ligand is designed to modulate the immune system as an anti-inflammatory agent. PMID:23497038
  22. oncogene metadherin modulates the apoptotic pathway based on the tumor necrosis factor superfamily member TRAIL (Tumor Necrosis Factor-related Apoptosis-inducing Ligand) in breast cancer PMID:23408429
  23. Data indicate that TNF-related apoptosis-inducing ligand knockout mice (TRAIL -/-) showed significantly decreased lung bacterial clearance and survival in response to Streptococcus pneumoniae. PMID:23071253
  24. Data indicate the importance of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) in pulmonary arterial hypertension (PAH) pathogenesis and suggest its potential as a therapeutic target to direct future translational therapies PMID:23071256
  25. data demonstrate that TRAIL induces osteoclastic differentiation via a TRAF-6 dependent signaling pathway PMID:22719861
  26. CD8+ T cells use TRAIL to restrict West Nile virus pathogenesis by controlling infection in neurons. PMID:22740407
  27. findings shed light on the possible anti-adipogenic and anti-inflammatory effects of TRAIL and open new therapeutic possibilities against obesity, systemic inflammation and T2DM PMID:22616837
  28. Epirubicin enhances the antiarthritic effect of rAAV2/5-TRAIL and that combination treatment might be an important therapeutic alternative, with practical significance for rheumatoid arthritis. PMID:22131069
  29. It was shown for the first time that TRAIL deficiency promotes numerous features of diabetes typical of human disease, and are associated with reduced insulin and pancreatic inflammation/apoptosis. PMID:21965021
  30. TRAIL strongly synergizes with APAP in inducing cell death in hepatocyte-like cells lines and primary hepatocyte. PMID:21654829
  31. the tumoricidal activity of CnB-activated peritoneal macrophages is partially dependent on TRAIL. PMID:22116828
  32. TRAIL regulates the magnitude of the influenza A virus (IAV)-specific CD8 T cell response during a clinically significant IAV infection to decrease the chance for infection-induced immunopathology. PMID:21940678
  33. TRAIL-deficient mice had an enhanced inflammatory response with increased neutrophil numbers and reduced neutrophil apoptosis PMID:21562052
  34. Data suggest that deficiency of TRADD sensitizes cells to TRAIL-induced apoptosis, and that enhanced cell death in TRADD(-/-) MEFs is associated with defective NF-kappaB activation. PMID:21627969
  35. study concludes that TRAIL attenuates plaque size at early stages of atherosclerosis PMID:21324463
  36. TRAIL and osteoprotegerin are expressed in atherosclerotic plaques in a calcification-prone mouse model PMID:21426505
  37. Data show that the number of tumors observed in TRAIL transgenic animals was significantly lower than in the control animals, and the lesions observed were mostly benign. PMID:21463519
  38. is not required for the development of peripheral lymphopenia or granuloma necrosis during infection with Mycobacterium avium PMID:21470210
  39. resveratrol can enhance the apoptosis-inducing potential of TRAIL by activating FKHRL1 and its target genes PMID:21209944
  40. CD8-positive regulatory T cells generated after anterior chamber injection of antigen via the retro-orbital plexus enforce systemic tolerance in a TRAIL-dependent manner to inhibit inflammation in the eye. PMID:21169546
  41. TRAIL suppresses autoimmunity by two mechanisms: the inhibition of Th1 cells and the promotion of Tregs PMID:20921531
  42. extrinsic and intrinsic pathways, via Trail/Dr5 and Puma respectively, could be engaged in distinct subpopulations of spermatogonia PMID:20711434
  43. sTRAIL is inversely associated with the mortality risk in chronic kidney disease patients. PMID:20190248
  44. Data show that in Abelson cells, the inhibition of both NF-kappaB and FoxO3a activity is required for suppression of TRAIL transcription and maintenance of the transformed state. PMID:20213318
  45. TRAIL- and GITRL-activated pathways synergise in the development of SCI-related inflammatory damage. PMID:20107429
  46. apoptotic cells generated during sepsis induced a CD8+ regulatory T cell that suppressed delayed-type hypersensitivity by TRAIL production PMID:20483771
  47. results indicate that cells that survive TRAIL treatment may do so by activation of a TAK1-NF-kappaB pathway that drives expression of cFlipL, and suggest that TAK1 may be a good target for overcoming TRAIL resistance PMID:20062539
  48. mice defective in both tumor necrosis factor-related apoptosis-inducing ligand and Fas ligand reveal new roles for TRAIL in lymphocyte homeostasis and autoimmune lymphoproliferative syndromes PMID:20185587
  49. TRAIL induction involves FGF-2, Sp1-phosphorylation and NFkappaB and that TRAIL promotes VSMC proliferation and neointima formation after arterial injury. PMID:20150555
  50. Data show that alpha-GalCer/AdmIL-2 treatment expanded the absolute numbers of lung and liver NK, NKT and T-cells as well as the TNF-related apoptosis-inducing ligand (TRAIL) expression of these cells. PMID:19901518

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Secreted.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Widespread.
Database Links

UNIGENE: Mm.1062

KEGG: mmu:22035

STRING: 10090.ENSMUSP00000040271

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1