Recombinant Mouse Tumor necrosis factor alpha-induced protein 3 (Tnfaip3)

Product Details

Abbreviation
Tnfaip3
Purity
>85% (SDS-PAGE)
Target Names
Tnfaip3
Uniprot NO.
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
2-371
Target Protein Sequence
AEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIYHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRSVQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAACQYMWGVQDTDLVLRKALCSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLVKMASADTPAARSGLQYNSLEEIHIFVLSNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSQHFVPLVTLKDSGPELRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLIVMEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSDQARRAAHAQN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities. Involved in immune and inflammatory responses signaled by cytokines, such as TNF-alpha and IL-1 beta, or pathogens via Toll-like receptors (TLRs) through terminating NF-kappa-B activity. Essential component of a ubiquitin-editing protein complex, comprising also RNF11, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. In cooperation with TAX1BP1 promotes disassembly of E2-E3 ubiquitin protein ligase complexes in IL-1R and TNFR-1 pathways; affected are at least E3 ligases TRAF6, TRAF2 and BIRC2, and E2 ubiquitin-conjugating enzymes UBE2N and UBE2D3. In cooperation with TAX1BP1 promotes ubiquitination of UBE2N and proteasomal degradation of UBE2N and UBE2D3. Upon TNF stimulation, deubiquitinates 'Lys-63'-polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Deubiquitinates TRAF6 probably acting on 'Lys-63'-linked polyubiquitin. Upon T-cell receptor (TCR)-mediated T-cell activation, deubiquitinates 'Lys-63'-polyubiquitin chains on MALT1 thereby mediating disassociation of the CBM (CARD11:BCL10:MALT1) and IKK complexes and preventing sustained IKK activation. Deubiquitinates NEMO/IKBKG; the function is facilitated by TNIP1 and leads to inhibition of NF-kappa-B activation. Upon stimulation by bacterial peptidoglycans, probably deubiquitinates RIPK2. Can also inhibit I-kappa-B-kinase (IKK) through a non-catalytic mechanism which involves polyubiquitin; polyubiquitin promotes association with IKBKG and prevents IKK MAP3K7-mediated phosphorylation. Targets TRAF2 for lysosomal degradation. In vitro able to deubiquitinate 'Lys-11'-, 'Lys-48'- and 'Lys-63' polyubiquitin chains. Inhibitor of programmed cell death. Has a role in the function of the lymphoid system. Required for LPS-induced production of proinflammatory cytokines and IFN beta in LPS-tolerized macrophages.
Gene References into Functions
  1. In mice, deletion of A20 in microglia increases microglial cell number and affects microglial regulation of neuronal synaptic function. Microglia A20 deficiency also exacerbates multiple sclerosis-like disease, due to hyperactivation of the Nlrp3 inflammasome leading to enhanced interleukin-1beta secretion and CNS inflammation. PMID:29789522
  2. A20 dimers bind linear ubiquitin to stabilize the Ripoptosome and potentiate its apoptosis-inducing activity. PMID:30209212
  3. At least in the subcutaneous fat of humans and mice, the levels of PGC-1a decrease during obesity, while its physical association with A20 increases. PMID:29678181
  4. T cell-specific A20 limited the expansion but reduced apoptosis and necroptosis of Listeria-specific CD8(+) T cells, resulting in an impaired pathogen control in primary but improved clearance in secondary infection. PMID:28004776
  5. study reveals a critical role of IL-17RC in maintaining baseline A20 production and a novel role of the IL-17RC-A20 axis in controlling JNK isoform-dependent tumor-specific homeostatic proliferation. PMID:28562353
  6. Deletion of TT>A enhancer results in inflammatory arthritis. PMID:29440643
  7. The data demonstrate that miR-125b regulates nasopharyngeal carcinoma cell proliferation and apoptosis by targeting A20/NF-kappaB signaling pathway, and miR-125b acts as oncogene, whereas A20 functions as tumor suppressor. PMID:28569771
  8. Mice with A20 deficient B cells are prone to food allergy. PMID:27825134
  9. Tnfaip3, an anti-inflammatory gene, is located precisely underneath the linkage peak and contains two non-synonymous SNPs leading to conservative amino acid substitutions. PMID:28116503
  10. Hepatitis C virus core protein ligates gC1qR to induce A20 expression in macrophages via P38, JNK and NF-kappaB signaling pathways, which leads to a low-grade chronic inflammation during HCV infection. PMID:27183919
  11. These results suggest that Leishmania exploits A20 and UCP2 to impair inflammasome activation for disease propagation PMID:28765172
  12. holding thymic production of natural Treg cells in check, A20 integrates Treg cell activity and increased effector T cell survival into an efficient CD4(+) T cell response PMID:28842469
  13. these studies establish A20 as a crucial hepatoprotective factor. PMID:27253414
  14. These results suggested that A20 is involved in regulating intracerebral hemorrhage-induced inflammatory injury in both the central and peripheral system PMID:27986908
  15. the ubiquitin-modifying enzyme TNFAIP3/A20, an upstream regulator of T cell receptor (TCR) signaling in T cells, is an essential cell-intrinsic regulator of Natural killer T differentiation. PMID:27551157
  16. these data reveal a crucial role of A20 in regulating the immunomodulatory activities of mesenchymal stem cells. PMID:27028905
  17. Therefore, A20 acts as a novel endogenous regulator of STAT1 that prevents onset of enthesitis. PMID:27551052
  18. This study demonstrated that miR-136-5p affected the expression of A20 in IL-17-stimulated astrocytes. PMID:28355611
  19. Our data suggest that NAOs have a beneficial preventive effect in septic shock correlated with the enhancement of IL-10 via the induction of A20 and COX-2. PMID:28363868
  20. Forced expression of A20 resulted in decreased expression of key markers of lipogenesis and adipogenesis, such as sterol regulatory element binding protein 1c (SREBP-1c) and adipogenesis (aP2), leading to less lipids accumulation in differentiated 3T3-L1 cells PMID:27443844
  21. these results suggest that Mycobacterium fortuitum-induced activation of host proinflammatory responses is negatively regulated through TLR2-dependent A20 expression. PMID:26940588
  22. knockdown of A20 in tumor site inhibited tumor growth at least through inducing the apoptosis of MDSCs. A20 might be a potential target in anticancer therapy. PMID:26561336
  23. MiR-221 directly targets A20, a master regulator of NF-kappaB and MAPK signaling, and thus represses inflammatory signaling. Restoration of A20 in macrophages abolished the stimulatory effect of miR-221 on production of proinflammatory cytokines. PMID:26549234
  24. A20 targets caspase-8 and FADD to protect HTLV-I-infected cells. PMID:26437781
  25. Our results show that miR-873 elevates A20 levels and inhibits morphine-induced macrophage apoptosis. PMID:25989384
  26. a significant influence of Tnfaip3 depletion on the expression of Tsc22d3, Pex7, Rap2a, Slc2a3, and Gap43 in stress response PMID:26546835
  27. we propose a mechanism of action by which A20 expression in club cells controls inflammation and antiviral cytotoxic T cell responses in response to influenza virus infection. PMID:26815999
  28. TNFAIP3 restricts MTOR signaling and promotes autophagy, providing new insight into the manner in which MTOR and autophagy regulate survival in CD4 T cells. PMID:26043155
  29. autophagy downregulates A20 in F4/80hi macrophages through p62-associated autophagic sequestration and that the resulting NFkappaB activation induces expression of chemokines at an early stage of Candida infection PMID:25609235
  30. Up-regulated A20 promotes proliferation, regulates cell cycle progression and induces chemotherapy resistance of acute lymphoblastic leukemia cells. PMID:26159495
  31. A20 knockout mice develop spontaneous intestinal defects. PMID:25267258
  32. ERRa is a negative regulator of TLR-induced inflammatory responses through inducing Tnfaip3 transcription and controlling the metabolic reprogramming. PMID:26200012
  33. these studies link A20 and the ubiquitination of RIPK3 to necroptotic cell death and suggest additional mechanisms by which A20 might prevent inflammatory disease. PMID:25939025
  34. Data suggest that the seventh zinc finger motif of A20 plays important role in NFkappaB-mediated apoptosis induced by tumor necrosis factor-alpha; A20 appears to bind and thus down-regulate inhibitor of apoptosis proteins cIAP1/2. PMID:25911380
  35. Brucella intracellular growth within macrophages occurs through up-regulation of A20 thereby limiting activation and macrophages cell death. PMID:25433453
  36. these findings show that DC-specific A20 preserves immune homeostasis in steady-state conditions and is also required for LPS tolerance. PMID:25472594
  37. Lack of the ubiquitin-editing enzyme A20 results in loss of hematopoietic stem cell quiescence. PMID:25624445
  38. inhibits inflammation via decreasing pro-IL-1beta-associated ubiquitination in a RIPK3-dependent manner PMID:25607459
  39. A20 deficiency causes spontaneous neuroinflammation in mice. PMID:25026958
  40. The findings identify A20 as a mediator of adiponectin anti-inflammatory action in white adipose tissue and a potential target for mitigating obesity-related pathology. PMID:25190567
  41. Our results thus indicate that the deubiquitinase activity of A20 is dispensable for normal NF-kappaB signaling. PMID:24878851
  42. These results demonstrate that A20 plays essential roles in the homeostasis of adult hematopoiesis by preventing apoptosis and inflammation. PMID:24498102
  43. results reveal A20 as a novel negative regulator of Nlrp3 inflammasome activation, and describe A20(myel-KO) mice as the first experimental model to study the role of inflammasomes in the pathology of rheumatoid arthritis PMID:25043000
  44. The anaphase-promoting complex protein 5 (AnapC5) associates with A20 and inhibits IL-17-mediated signal transduction. PMID:23922952
  45. A20-deficient mast cells exacerbate inflammatory responses in vivo. PMID:24453940
  46. Bcl10 is an essential regulator for A20 gene expression. PMID:23677497
  47. Tnfaip3 was over-expressed in microglia following knockdown of miR-29b. PMID:24236890
  48. studies define the critical opposing functions of DREAM and USF1 in inhibiting and inducing A20 expression PMID:24487321
  49. Tnfaip3 is regulated by both NF-kappaB and p38-dependent C/EBPbeta PMID:24023826
  50. A20 zinc finger protein plays an anti-inflammatory role and protects against liver injury associated with trauma combined with lipopolysaccharide challenge. PMID:24055365

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Lysosome.
Protein Families
Peptidase C64 family
Tissue Specificity
Found in most tissues during development. Strikingly high levels are found in lymphoid organs, including the thymus, spleen, and gut-associated lymphoid tissue. Constitutively expressed in immature and mature thymocyte subpopulations as well as in resting
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1