Recombinant Mouse Thyroxine-binding globulin (Serpina7)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Serpina7
Uniprot NO.
Alternative Names
Serpina7; Tbg; Thyroxine-binding globulin; Serpin A7; T4-binding globulin
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
21-418
Target Protein Sequence
APHNSSEGKVTTCHLPQQNATLYKMPSINADFAFSLYRRLSVENPDLNIFFSPVSISVAL AMLSFGSGSSTQTQILEVLGFNLTDTPVTELQQGFQHLICSLNFPKNELELQMGNAVFIG QQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHKINSYVEKQTKGKIVGLIQGLKLNII MILVNYIHFRAQWANPFRVSKTEESSNFSVDKSTTVQVPMMHQLEQYYHYVDMELNCTVL QMDYSENALALFVLPKEGHMEWVEAAMSSKTLKKWNYLLQKGWVELFVPKFSISATYDLG STLQKMGMRDAFAESADFPGITEDSGLKLSYAFHKAVLHIGEEGTKEGASPEVGSLDQQE VPPLHPVIRLDRAFLLMILEKRTRSVLFLGKLVNPTKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Major thyroid hormone transport protein in serum.
Gene References into Functions
  1. the TBG promoter has a role in sustaining transgene expression in liver-specific pattern PMID:22820390

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Serpin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1