Recombinant Mouse Thrombospondin-2 (Thbs2), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Thbs2
Uniprot NO.
Research Area
Others
Alternative Names
Thbs2; Tsp2; Thrombospondin-2
Source
Baculovirus
Expression Region
19-232aa
Target Protein Sequence
GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
N-terminal His-tagged and C-terminal Myc-tagged/N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.
Gene References into Functions
  1. Data provide evidence that TSP2 transcription is suppressed by hypoxia through a mechanism that requires HIF-1alpha. PMID:28789925
  2. TWIST2 induces miR-221-3p expression and consequently suppresses its direct target, THBS2, in lymphatic metastasis cervical cancer. PMID:29242498
  3. TSP2 deficiency imparted a brittle phenotype on cortical bone. electron microscopy revealed less intensely stained collagen fibrils with altered morphology in the extracellular matrix assembled by osteoblasts on the anterior surface of TSP2-KO femora. PMID:26272319
  4. Enhanced levels of TSP-2 in the skin result in reduced susceptibility to chemically-induced skin carcinogenesis. PMID:24507936
  5. in the context of osteoblast differentiation, TSP2 promotes the assembly of a type-I collagen-rich matrix by facilitating pro-collagen processing. PMID:23763373
  6. The proposed mechanism for the shift in stem cell fate in fracture healing is that increased vascular density and hence oxygen availability in TSP2-null mice regulates differentiation. PMID:23775935
  7. The upregulation of TSP-2 mediated by increased oxidative stress contributes to angiogenesis dysfunction in diabetic bone marrow derived angiogenic cells. PMID:23723366
  8. TSP2 is a negative regulator of ischemic fracture healing, and in the absence of TSP2 bone regeneration is enhanced. PMID:23280580
  9. Using a TSP-2-knockout mouse model and cardiac cell transplantation, we found significantly reduced fibrosis and increased endothelial cell density in the peri-graft region. PMID:22512900
  10. the two TSP2 isforms are differentially modulated at injured and noninjured skeletal sites in an animal undergoing fracture healing. PMID:22362307
  11. TSP-2 has a protective role against cardiac inflammation, injury, and dysfunction in acute viral myocarditis. PMID:22308237
  12. astrocyte-derived TSP-2 is critical for the maintenance of physiological MMP-2 and MMP-9 levels during the foreign body response and contributes to the repair of the BBB PMID:21704005
  13. Endothelial nitric oxide synthase controls the expression of the angiogenesis inhibitor thrombospondin 2 PMID:21949402
  14. The secreted protein is an autocrine inhibitor of marrow stromal cell proliferation. PMID:11874233
  15. Megakaryocytes require this protein for normal platelet formation and function. PMID:12732502
  16. Thrombospondin 2 regulates cell proliferation induced by Rac1 redox-dependent signaling PMID:12861025
  17. TSP2-null mice provide an animal model to assist in the understanding of the molecular basis of spontaneous, premature softening of the uterine cervix. PMID:14561659
  18. Delay in expression of TSP2 and metalloproteinase 2 in the wounds of aged mice could contribute to their impaired rate of wound healing. PMID:14996433
  19. CD36 mediates the antiangiogenic effect of thrombospondin-2, which is modulated by histidine-rich glycoprotein PMID:15748999
  20. the absence of TSP2 protects against ovariectomy-induced bone loss by two complementary processes: increased formation and decreased resorption. PMID:15979292
  21. Mutations targeting intermodular interfaces or calcium binding destabilize the thrombospondin-2 signature domain. PMID:18682400
  22. TSP-2 was found to be present in some, but not all, annulus cells of the human annulus and the mouse annulus. PMID:18718009
  23. Taken together, our observations support a role for TSP2 as critical determinant of the brain response to biomaterials. PMID:19020342
  24. TSP-2 expression in the heart protects against age-dependent dilated cardiomyopathy. PMID:19805649

Show More

Hide All

Protein Families
Thrombospondin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1