Recombinant Mouse Synaptonemal complex protein 3 (Sycp3)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Sycp3
Uniprot NO.
Alternative Names
Sycp3; Scp3; Synaptonemal complex protein 3; SCP-3
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
1-254
Target Protein Sequence
MLRGCGDSDSSPEPLSKHLKMVPGGRKHSGKSGKPPLVDQPKKAFDFEKDDKDLSGSEED VADEKAPVIDKHGKKRSAGIIEDVGGEVQNMLEKFGADINKALLAKRKRIEMYTKASFKA SNQKIEQIWKTQQEEIQKLNNEYSQQFMNVLQQWELDIQKFEEQGEKLSNLFRQQQKIFQ QSRIVQSQRMFAMKQIHEQFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKVMMETQQQ EMANVRKSLQSMLF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Component of the synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for centromere pairing during meiosis in male germ cells. Required for normal meiosis during spermatogenesis and male fertility. Plays a lesser role in female fertility. Required for efficient phosphorylation of HORMAD1 and HORMAD2.
Gene References into Functions
  1. Unlike other vertebrates, rat and mouse SYCP3 exists in 2 isoforms; the short isoform is conserved in vertebrates and the longer isoform, appeared 15 million years ago in a common ancestor of rat and mouse and after separation from the hamster branch. PMID:20339291
  2. X-linked lymphocyte-regulated protein pM1 (XMR), XLR, and SCP3 render tumor cells resistant to antitumor immunity PMID:20395201
  3. absence of synaptonemal complex protein 3 (SCP3) promotes aneuploidy in murine oocytes by inducing defective meiotic chromosome segregation PMID:12004129
  4. In Scp3-deficient (knockout) mice, spermatogenesis and testicular degeneration are augmented when E2F1 is also deficient. PMID:14685160
  5. Rad21, and the superimposed SCP3 and SCP2, are involved in the monopolar attachment of sister kinetochores during meiosis I PMID:14970259
  6. SYCP2 and SYCP3 proteins function in the specificity of chromatin attachment to the chromosome core PMID:15237206
  7. SYCP3 has a temporally restricted role in maintaining, but not establishing, cohesin-core organization during prophase I. PMID:15870106
  8. The SYCP3 is expressed in germ cell-like cells. The nuclear distribution of SYCP3 in the germ cell-like cells is highly abnormal and not associated with the chromosomes of these cells. PMID:16644921
  9. DNA double-stranded breaks are inefficiently repaired in Sycp3(-)(/)(-) oocytes, thereby generating a temporal spectrum of recombination errors. T PMID:16717125
  10. Sycp3 is a biologically relevant target of Dazl-mediated translation in mammals. PMID:17526644

Show More

Hide All

Subcellular Location
Nucleus. Chromosome. Chromosome, centromere.
Protein Families
XLR/SYCP3 family
Tissue Specificity
Detected in oocytes. Detected in spermatocytes and testis (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1