Home
Product
Protein
Recombinant Proteins
Recombinant Mouse Synaptonemal complex protein 3 (Sycp3)

Recombinant Mouse Synaptonemal complex protein 3 (Sycp3)

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

Sycp3

Uniprot NO.

P70281

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

1-254

Target Protein Sequence

MLRGCGDSDSSPEPLSKHLKMVPGGRKHSGKSGKPPLVDQPKKAFDFEKDDKDLSGSEED VADEKAPVIDKHGKKRSAGIIEDVGGEVQNMLEKFGADINKALLAKRKRIEMYTKASFKA SNQKIEQIWKTQQEEIQKLNNEYSQQFMNVLQQWELDIQKFEEQGEKLSNLFRQQQKIFQ QSRIVQSQRMFAMKQIHEQFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKVMMETQQQ EMANVRKSLQSMLF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Component of the synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for centromere pairing during meiosis in male germ cells. Required for normal meiosis during spermatogenesis and male fertility. Plays a lesser role in female fertility. Required for efficient phosphorylation of HORMAD1 and HORMAD2.

Gene References into Functions

Unlike other vertebrates, rat and mouse SYCP3 exists in 2 isoforms; the short isoform is conserved in vertebrates and the longer isoform, appeared 15 million years ago in a common ancestor of rat and mouse and after separation from the hamster branch. PMID:20339291
X-linked lymphocyte-regulated protein pM1 (XMR), XLR, and SCP3 render tumor cells resistant to antitumor immunity PMID:20395201
absence of synaptonemal complex protein 3 (SCP3) promotes aneuploidy in murine oocytes by inducing defective meiotic chromosome segregation PMID:12004129
In Scp3-deficient (knockout) mice, spermatogenesis and testicular degeneration are augmented when E2F1 is also deficient. PMID:14685160
Rad21, and the superimposed SCP3 and SCP2, are involved in the monopolar attachment of sister kinetochores during meiosis I PMID:14970259
SYCP2 and SYCP3 proteins function in the specificity of chromatin attachment to the chromosome core PMID:15237206
SYCP3 has a temporally restricted role in maintaining, but not establishing, cohesin-core organization during prophase I. PMID:15870106
The SYCP3 is expressed in germ cell-like cells. The nuclear distribution of SYCP3 in the germ cell-like cells is highly abnormal and not associated with the chromosomes of these cells. PMID:16644921
DNA double-stranded breaks are inefficiently repaired in Sycp3(-)(/)(-) oocytes, thereby generating a temporal spectrum of recombination errors. T PMID:16717125
Sycp3 is a biologically relevant target of Dazl-mediated translation in mammals. PMID:17526644