Recombinant Mouse Solute carrier family 2, facilitated glucose transporter member 1 (Slc2a1), partial

Code: CSB-EP021546MO
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$554
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: Tag-Free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Slc2a1
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
Glucose transporter type 1, erythrocyte/brain
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
451-492aa
Target Protein Sequence
KVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
4.5 kDa
Protein Length
Partial
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain. In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors.
Gene References into Functions
  1. Biochemical studies identify a Bmp-mTORC1-Hif1a signaling cascade resulting in upregulation of Glut1 in chondrocytes that is essential for murine skeletal development. PMID:30446646
  2. Adequate Glut1 protein is indispensable for the proper development and maintenance of the capillary network of the brain. PMID:28106060
  3. GLUT1 may play an important role in Prostate Cancer progression via mediating glycolysis and proliferation. There is potential crosstalk between GLUT1-mediated glycolysis and androgen sensitivity in Prostate Cancer. PMID:29105798
  4. ARAP2 knockdown did not affect fatty acid uptake but reduced basal glucose uptake, total levels of the glucose transporter GLUT1, and GLUT1 levels in the plasma membrane and the lipid micro-domain fraction. PMID:27476102
  5. TBC1D5 shuttling to autophagosomes during metabolic stress facilitates retromer-dependent GLUT1 trafficking. PMID:28602638
  6. inhibition of GLUT1 activity and/or expression is shown to impair TGF-beta-driven fibrogenic processes, including cell proliferation and production of profibrotic mediators PMID:27480571
  7. B cell leukemia-induced inhibition of T cell Akt/mTORC1 signaling and glucose metabolism drives T cell dysfunction; metabolic defects included reduced Akt/mammalian target of rapamycin complex 1 (mTORC1) signaling, decreased expression of the glucose transporter Glut1 and hexokinase 2, and reduced glucose uptake PMID:27511728
  8. This study demonstrates a strict requirement for GLUT1 in the early stages of mammary tumorigenesis in vitro and in vivo. PMID:27998284
  9. GLUT1-dependent glycolysis regulates fibrogenesis in aged lung. PMID:27997810
  10. Data (including data from studies using transgenic mice) suggest that Glut1 (glucose transporter type 1) is a critical downstream target of Hif1a (hypoxia-inducible factor 1, alpha subunit) mediating hyperglycemia-induced extracellular matrix accumulation in kidney via regulation of Nox4 (NADPH oxidase type 4) expression in nephropathy due to diabetes type 1. PMID:26908870
  11. CRISPR/Cas9-mediated disruption of the Hdac2 gene increased Slc2a1 expression, suggesting that it is one of the responsible histone deacetylases (HDACs). These results confirm that b-OHB is a HDAC inhibitor and show that b-OHB plays an important role in fasting-induced epigenetic activation of a glucose transporter gene in the brain. PMID:27935189
  12. Taken together, the data suggest that curcumin binds directly to GLUT1 at a site that overlaps with the cytochalasin B binding site and thereby inhibits glucose transport. PMID:27039889
  13. overnutrition during early life induces short-term metabolic disturbances, impairment in heart insulin signaling, up-regulates GLUT-1 and switch cardiac fuel preference in juvenile mice PMID:26608021
  14. alpha(1)-AR activation is anti-apoptotic and protective during cardiac ischemia due to glucose deprivation and not hypoxia by enhancing glucose uptake into the heart via PKCdelta-mediated GLUT translocation that may be specific to the alpha(1A)-AR subtype. PMID:26832303
  15. Glut1 connects the enhanced glucose uptake in atheromatous plaques of ApoE(-/-) mice with their myelopoiesis through regulation of hematopoietic stem and multipotential progenitor cell maintenance and myelomonocytic fate. PMID:26926469
  16. Enhanced GLUT1 expression in melanoma cells favors their metastatic behavior. PMID:26293674
  17. bright-field microscopy designed to automatically identify and segment microvessels containing the protein glucose transporter 1. PMID:26828723
  18. Morphological changes and GLUT1, GLUT3, and GLUT4 expression were evaluated in placentas by immunohistochemical and image analysis and correlated with iAs and arsenical species concentration, which were quantified by atomic absorption spectroscopy PMID:26339590
  19. Nicotine pre-exposure reduced the ischemic-reperfusion-enhanced glucose transporter-1 function and expression at the blood brain barrier in a focal brain ischemia mouse model. PMID:25925411
  20. A lack of effect on gene expression, changes in the protein expression patterns of the key genes GLUT1/SLC2A1 and HK2 were observed after radiation treatment. PMID:25304950
  21. Glut1 deficiency decreased Teff expansion and the ability to induce inflammatory disease in vivo. PMID:24930970
  22. GLUT1 deficiency in cardiomyocytes does not accelerate the transition from compensated hypertrophy to heart failure. PMID:24583251
  23. Beta 3-adrenoceptors stimulate glucose uptake in brown adipose tissue via cAMP-mediated increases in GLUT1 transcription and synthesis and mTOR complex 2-stimulated translocation of newly synthesized GLUT1 to the plasma membrane. PMID:25385184
  24. GLUT1 brain levels in scrapie-infected animals was unchanged compared to controls. PMID:24243341
  25. Cysteine biochemistry is utilized in both methylene blue and berberine activation of glucose uptake by GLUT1. PMID:24333987
  26. glucose transporter 1 (GLUT1)-mediated glucose metabolism has a role in the proinflammatory phenotype PMID:24492615
  27. Placental endoplasmic reticulum stress by administration of Tun causes downregulation of Slc2a1(GLUT1) and upregulation of Slc2a3(GLUT3) mRNA expression. PMID:24370435
  28. Data indicate that tumor tissues from idh2-/- ((knock-out) mice had significantly decreased HIF-1alpha expression, blunted mRNA expression of HIF-1alpha, VEGF, and the glucose transport protein Glut-1 was also observed. PMID:24240089
  29. Quantitative real-time polymerase chain reaction revealed up-regulation of hypoxia and oxidative stress related genes, including Slc2a1. PMID:23429070
  30. Access to a running wheel for 48h induced plastic changes in the expression of astrocyte GLUT1. A significant increase was found only in motor cortex, though other motor related areas showed a similar trend(sensorimotor cortex, striatum and cerebellum). PMID:23201358
  31. Loss of neuronatin caused a reduction in both basal and insulin-stimulated glucose uptake and glycogen synthesis, likely mediated by a reduction in Glut1 protein upon silencing of neuronatin. PMID:23482445
  32. The results of this study demonstrated that valproic acid, a known histone deacetylases inhibitor, increased the glucose transport capacity in SLC2A1 heterozygous cerebral astrocytes of mice. PMID:22532550
  33. metabolite receptors (Slc2a1 and Ldr) were down-regulated in diet-induced obese mice PMID:23001779
  34. Heptanoate as a neural fuel: energetic and neurotransmitter precursors in normal and glucose transporter I-deficient (G1D) brain PMID:23072752
  35. GLUT1 siRNA blocked the 6-phenyl cAMP-induced increase in embryonic stem cell proliferation. PMID:22658979
  36. Report GLUT1 expression in normal left ventricle and in models of dilated and hypertophic cardiomyopathy. PMID:22681646
  37. Acute fasting decreases GLUT1 expression and glucose utilisation, inhibiting the processes of oocyte maturation and cumulus cell expansion. PMID:22697123
  38. Data show that an intense glucose transporter 1 (GLUT1)-immunoreaction was localized in the enamel organ of bud-stage molar tooth germs, where the active cell proliferation occurred. PMID:22226978
  39. Data suggest that GnRH up-regulates expression/localization of Glut1 (but not Glut2, Glut4, or Glut8) and stimulates glucose utilization in gonadotrophs; effects of GnRH on Glut1 mRNA expression are partly mediated by ERK activation/phosphorylation. PMID:22107955
  40. Studies demonstrate that GLUT1 is the major glucose transporter in mouse mammary carcinoma models overexpressing ErbB2 or PyVMT. PMID:21826239
  41. GLUT1 enhances mTOR activity independently of TSC2 and AMPK. PMID:21613414
  42. Fibroblast growth factor 21 induces glucose transporter-1 expression through activation of the serum response factor/Ets-like protein-1 in adipocytes PMID:21846717
  43. Data suggest that a portion of the hypoglycemic effects of berberine can be attributed to its acute activation of the transport activity of GLUT1. PMID:21545824
  44. The expression of GLUT1 in the ovary was generally weak with an intense expression of GLUT1 only in some vascular endothelia. PMID:21360229
  45. Findings suggest that GLUT1 mRNA expression is essential for decidualization. PMID:21343253
  46. Data show that CA9, GLUT1 and LOX mRNA levels were equally and strongly correlated to hypoxic extent in FaDudd, and the same was observed for CA9 and GLUT1, but not LOX, in SCCVII tumors. PMID:21306648
  47. adipose-specific deletion of SCD1 induces GLUT1 up-regulation in adipose tissue, suggesting that GLUT1 may play a critical role in controlling glucose homeostasis of adipose tissue in adipose-specific SCD1-deficient conditions. PMID:20655875
  48. GLUT1-VEGF-GLUT1 positive feedback loop may play a key role in contributing to renal disease in this model of nondiabetic glomerulosclerosis. PMID:19918242
  49. Expression is increased by exposure to tolbutamide in embryonic heart in vitro. Effect is concentration-dependent. PMID:11835228
  50. induction resulting from activation of prolyl hydroxylase oxygen-sensor PMID:12649278

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Photoreceptor inner segment.
Protein Families
Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily
Tissue Specificity
Retina (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products