Recombinant Mouse Signal transducing adapter molecule 1 (Stam)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Stam
Uniprot NO.
Alternative Names
Stam; Stam1; Signal transducing adapter molecule 1; STAM-1
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
2-548
Target Protein Sequence
PLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHV AMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKN DPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAIE LSLKEQRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFEAAEDNELTFKAGEIITVLD DSDPNWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKTVQFNDDVQIETIEPEPEPAF IDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELN VKVMEALSLYTKLMNEDPMYSMYAKLQSQQYYLQSSAVSASQVYPGPAQSGTYLVAGSAQ MTHLQSYSLPPEQLSSISQGAVPSSANQALPSQQTQASYPNAMVSSVQGNSYPSQASIYS PPAAAAAAAAAAVVPVPVPADVTIYQNAGPTMSQVPNYTLTSSTLPQTGGSQQPPQPQQA YSQKALL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes.
Gene References into Functions
  1. the motor neuron-specific ISL1-LHX3 complex directly transactivates the Stam1 gene. PMID:27161150
  2. ESCRT-0 protein hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) is targeted to endosomes independently of signal-transducing adaptor molecule (STAM) and the complex formation with STAM promotes its endosomal dissociation. PMID:25296754
  3. These results demonstrate that the STAMs are indispensably involved in T-cell development and survival in the thymus through the prevention of apoptosis but are dispensable for the proximal signaling of TCR and cytokine receptors. PMID:12446783
  4. plays important role in the mammalian endosomal/vacuolar protein sorting pathway PMID:13679051
  5. Hrs is a master molecule that controls in part the degradation of STAM1 and the accumulation of ubiquitinated proteins PMID:15640163

Show More

Hide All

Subcellular Location
Cytoplasm. Early endosome membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
STAM family
Tissue Specificity
Ubiquitously expressed. Enriched expression in synaptic vesicles.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1