Recombinant Mouse Serine/threonine-protein kinase mTOR (Mtor)

Product Details

Abbreviation
Mtor
Purity
>85% (SDS-PAGE)
Target Names
Mtor
Uniprot NO.
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
1-256
Target Protein Sequence
MLGTGPAVATASAATSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDP VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRVRDGS TQPLAKHFGLESCSWP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein of Isoform 2
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Serine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals. MTOR directly or indirectly regulates the phosphorylation of at least 800 proteins. Functions as part of 2 structurally and functionally distinct signaling complexes mTORC1 and mTORC2 (mTOR complex 1 and 2). Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. This includes phosphorylation of EIF4EBP1 and release of its inhibition toward the elongation initiation factor 4E (eiF4E). Moreover, phosphorylates and activates RPS6KB1 and RPS6KB2 that promote protein synthesis by modulating the activity of their downstream targets including ribosomal protein S6, eukaryotic translation initiation factor EIF4B, and the inhibitor of translation initiation PDCD4. This also includes mTORC1 signaling cascade controlling the MiT/TFE factors TFEB and TFE3: in the presence of nutrients, mediates phosphorylation of TFEB and TFE3, promoting their cytosolic retention and inactivation. Upon starvation or lysosomal stress, inhibition of mTORC1 induces dephosphorylation and nuclear translocation of TFEB and TFE3, promoting their transcription factor activity. Stimulates the pyrimidine biosynthesis pathway, both by acute regulation through RPS6KB1-mediated phosphorylation of the biosynthetic enzyme CAD, and delayed regulation, through transcriptional enhancement of the pentose phosphate pathway which produces 5-phosphoribosyl-1-pyrophosphate (PRPP), an allosteric activator of CAD at a later step in synthesis, this function is dependent on the mTORC1 complex. Regulates ribosome synthesis by activating RNA polymerase III-dependent transcription through phosphorylation and inhibition of MAF1 an RNA polymerase III-repressor. In parallel to protein synthesis, also regulates lipid synthesis through SREBF1/SREBP1 and LPIN1. To maintain energy homeostasis mTORC1 may also regulate mitochondrial biogenesis through regulation of PPARGC1A. mTORC1 also negatively regulates autophagy through phosphorylation of ULK1. Under nutrient sufficiency, phosphorylates ULK1 at 'Ser-758', disrupting the interaction with AMPK and preventing activation of ULK1. Also prevents autophagy through phosphorylation of the autophagy inhibitor DAP. Also prevents autophagy by phosphorylating RUBCNL/Pacer under nutrient-rich conditions. Prevents autophagy by mediating phosphorylation of AMBRA1, thereby inhibiting AMBRA1 ability to mediate ubiquitination of ULK1 and interaction between AMBRA1 and PPP2CA. mTORC1 exerts a feedback control on upstream growth factor signaling that includes phosphorylation and activation of GRB10 a INSR-dependent signaling suppressor. Among other potential targets mTORC1 may phosphorylate CLIP1 and regulate microtubules. As part of the mTORC2 complex MTOR may regulate other cellular processes including survival and organization of the cytoskeleton. Plays a critical role in the phosphorylation at 'Ser-473' of AKT1, a pro-survival effector of phosphoinositide 3-kinase, facilitating its activation by PDK1. mTORC2 may regulate the actin cytoskeleton, through phosphorylation of PRKCA, PXN and activation of the Rho-type guanine nucleotide exchange factors RHOA and RAC1A or RAC1B. mTORC2 also regulates the phosphorylation of SGK1 at 'Ser-422'. Regulates osteoclastogenesis by adjusting the expression of CEBPB isoforms. Plays an important regulatory role in the circadian clock function; regulates period length and rhythm amplitude of the suprachiasmatic nucleus (SCN) and liver clocks. Phosphorylates SQSTM1, promoting interaction between SQSTM1 and KEAP1 and subsequent inactivation of the BCR(KEAP1) complex.
Gene References into Functions
  1. studies suggest that mTOR regulates vascular integrity and function and that mTOR attenuation may restore neurovascular function and cardiovascular health PMID:28511572
  2. Decreased liver mRNA levels for multiple genes associated with mTOR signaling and oxidative stress parameters were detected in aldh5a1(-/-) mice, and several were significantly improved with the administration of mTOR inhibitors (Torin 1/Torin 2). PMID:27760377
  3. Results suggest that activation of mammalian target of rapamycin (mTOR)/reactive oxygen species (ROS)/NOD-like receptor protein 3 (NLRP3) signaling may contribute to the development of systemic lupus erythematosus (SLE). PMID:30060081
  4. mTOR coordinates transcriptional and metabolic programs in activated Regulatory T cell subsets to mediate tissue homeostasis. PMID:29844370
  5. Regnase-1 predominantly regulates mTORC1 signaling. PMID:30297433
  6. Study shows that GLP-1 receptor signalling promotes beta-cell glucose metabolism via mTOR-dependent HIF-1alpha activation. findings suggest that chronic GLP-1 actions on insulin secretion include elevated beta-cell glucose metabolism. Moreover, our data reveal novel aspects of GLP-1 stimulated insulin secretion involving de novo gene expression. PMID:28572610
  7. metabolic profiling reveals elevated glycolysis and increased mTORC1 signaling in Ndfip1-deficient Treg cells PMID:28580955
  8. Sesn2/AMPK/mTOR signaling mediates balance between survival and apoptosis in sensory hair cells under stress. PMID:28981119
  9. the present study suggested that Pulsed electromagnetic fields (PEMFs) reduced osteoclast formation from RAW264.7 macrophages via inhibition of the Akt/mTOR signaling pathway. These findings provided novel insight into the mechanisms through which PEMFs suppress osteoclast differentiation. PMID:29749519
  10. mTOR signaling is a key mediator of central insulin dysfunction, which leads to pathogenesis of Alzheimer disease. PMID:29729422
  11. Results indicate that L-Arg stimulates protein synthesis via the activation of the mTOR (Thr 2446)/p70S6K signaling pathway in an NO-dependent manner. PMID:29854093
  12. High mTOR expression is associated with cardiac hypertrophy. PMID:30125581
  13. cPKC&-gamma modulated sequential reactivation of mTOR inhibited autophagic flux in neurons exposed to OGD/R, which may provide endogenous interventional strategies for stroke, especially ischemia/reperfusion injury PMID:29734780
  14. findings suggest that deficiencies of leucine and isoleucine reduce type I and III tropocollagen syntheses in skin by suppressing the action of mTOR PMID:29191093
  15. MTOR-dependent pathways in primordial or growing oocytes differentially affected downstream processes including follicular development, sex-specific identity of early granulosa cells, maintenance of oocyte genome integrity, oocyte gene expression, meiosis, and preimplantation developmental competence. PMID:29784807
  16. The control of cMaf expression at the translational level by mTOR regulated the expression of inflammatory genes in response to lipopolysaccharide challenge. PMID:29484383
  17. The function of mTOR in epidermal morphogenesis is split between mTORC1 and mTORC2. Whereas mTORC1 mainly controls keratinocyte proliferation within the basal layer, early epidermal stratification and differentiation, mTORC2 primarily controls cell division orientation and late stage barrier formation of the interfollicular epidermis. PMID:27807348
  18. Loss of mTOR in vasoactive intestinal peptide neurons displayed erratic circadian behavior and weakened synchronization among cells in the suprachiasmatic nucleus, the master circadian pacemaker. PMID:29555746
  19. T1R1/T1R3 modulates the mTOR pathway to regulate milk protein synthesis in the mouse mammary gland in vivo. PMID:28497545
  20. the protein expression levels of mTOR were significantly reduced in spinal cord injury (SCI) neurons, whereas transfection with a miR99b5p inhibitor suppressed the SCIinduced reduction of mTOR. PMID:29039596
  21. Adoptive transfer with targeting-mTOR strategy markedly improves neuronal recovery after ONI, supporting the therapeutic potentials of Tregs in acute and chronic neurological disorder PMID:27886260
  22. Activation of the mTOR pathway was partially repressed by T1R1 siRNA or SLC7A5/SLC3A2 inhibitor (BCH, 10 mM), and the combination of these two treatments further repressed the activity of mTOR pathway. PMID:27539583
  23. Ggpps deletion enhanced Rheb farnesylation, which subsequently activated mTORC1 and facilitated spermatogonial differentiation PMID:27374985
  24. mTOR is crucial for T-cell accumulation in the GI tract and for establishing local adaptive immunity against pathogens. PMID:27731345
  25. Data show that mammalian/mechanistic target of rapamycin (mTOR) perturbation alters the suprachiasmatic nucleus (SCN) clock oscillations. PMID:29750810
  26. These data demonstrate that the activated mTOR by Erk1/2 results in energy consumption, which in turn leads to endoplasmic reticulum stress signaling and thus induces apoptosis in high glucose-treated podocytes. PMID:29554648
  27. Inhibition of mammalian target of rapamycin (mTOR) activation using rapamycin restored Mb mRNA expression to control levels. Lipid supplementation had no effect on Mb gene expression. Thus, IGF-1-induced anabolic signaling can be a strategy to improve muscle size under mild hypoxia, but lowers Mb gene expression PMID:28862673
  28. These results demonstrate that mTOR acts as a molecular rheostat of natural killer cell reactivity controlled by educating receptors and uncover how cytokine stimulation overcomes natural killer cell education. PMID:28875936
  29. ResultsPIA suppressed phosphorylation of all mTOR proteins PMID:28399115
  30. MTOR plays a critical role in the regulation of cortical interneuron number and autophagy in the developing brain. PMID:28598226
  31. in the central nervous systems (CNS), the mammalian target of rapamycin (mTOR) pathway plays a critical role in regulating the regenerative capacity of neurons. PMID:28666378
  32. mRNA localization enables spatiotemporal control of mTOR pathways regulating local translation and long-range intracellular signaling. PMID:29567716
  33. These findings revealed mTOR overactivation in mesenchymal cells aggravates CCl4- induced liver fibrosis and the rapamycin prevent its occurance. PMID:27819329
  34. present study demonstrates that endothelial mTORC1 deletion protects against hindlimb ischemic injury in diabetic mice possibly via activation of autophagy, attenuation of oxidative stress and alleviation of inflammation PMID:28473248
  35. The AMPK, mTOR and p70S6K proteins were not significantly changed. PMID:28738521
  36. Preventive function of Sirt1 may be the inhibition of mTOR phosphorylation, whereas mTOR activity was shown to be a pathogenic culprit of systemic sclerosis in the current research. PMID:28532580
  37. CRP is pathogenic in type-2 diabetes (T2DN). CRP may promote CD32b- NF-kappaB signaling to mediate renal inflammation; whereas, CRP may enhance renal fibrosis in T2DN via CD32b-Smad3-mTOR signaling. PMID:27221338
  38. These results reveal a novel role of miR-199a as a key regulator of cardiac autophagy. PMID:26160071
  39. An FAK-YAP-mTOR Signaling Axis Regulates Stem Cell-Based Tissue Renewal in Mice. PMID:28457749
  40. Our results suggest that mTORC1/mTORC2 dual inhibition is more effective for anti-angiogenic therapy, as it impairs not only endothelial cell proliferation, but also endothelial cell elongation. PMID:29428724
  41. These results reveal that MTOR is dispensable for the maintenance of undifferentiated spermatogonia, but is cell autonomously required for their proliferation and differentiation. PMID:28379293
  42. mTOR mediates metabolic adaptation of antigen-presenting cells in distinct tissues, influencing the immunological character of allergic inflammation. PMID:28798047
  43. mTOR Inhibition Subdues Milk Disorder Caused by Maternal VLDLR Loss PMID:28591574
  44. AKAP1 is a transcriptional target of Myc, and it supports mTOR pathway and the growth of cancer cells. PMID:28569781
  45. our results show that the phosphorylation of 4E-BP1 promotes translation at the onset of meiosis to support the spindle assembly and suggest an important role of CDK1 and mTOR kinases in this process PMID:28272965
  46. Inhibition of mTOR complex 1 is closely associated with aging and prolonged life span of fission yeast. PMID:28526373
  47. Suggest that hyperactivation of the mTOR pathway is involved in the development of endometrial hyperplasia with aging. PMID:27980219
  48. Abeta increases the expression of mTOR and p-mTOR at the site of Ser2448, and the stimulation of Abeta is likely to depend on sirtuin 1, PPARgamma, and PGC-1beta pathway in regulating mTOR expression. PMID:27631411
  49. In mTOR gene deletion, the astrocyte population exhibited a lower seizure frequency compared with controls in an animal model of temporal lobe epilepsy. PMID:26732600
  50. UVB-irradiated or aged mice skin revealed that mTORC2 activity was significantly upregulated which in turn increased Akt activation and Akt-dependent IkappaB kinase alpha (IKKalpha) phosphorylation, and The increased mTORC2 signaling pathway during skin aging were associated to NF-kappaB activation. PMID:27486771

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. Lysosome. Cytoplasm. Nucleus, PML body. Lysosome membrane. Cytoplasmic vesicle, phagosome.
Protein Families
PI3/PI4-kinase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1