Recombinant Mouse Retinoid isomerohydrolase (Rpe65)

Product Details

Abbreviation
Rpe65
Purity
>85% (SDS-PAGE)
Target Names
Rpe65
Uniprot NO.
Alternative Names
Rpe65; Retinoid isomerohydrolase; EC 3.1.1.64; All-trans-retinyl-palmitate hydrolase; Lutein isomerase; Meso-zeaxanthin isomerase; EC 5.3.3.22; Retinal pigment epithelium-specific 65 kDa protein; Retinol isomerase
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
2-533
Target Protein Sequence
SIQIEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLF DGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFS YFKGVEVTDNALVNIYPVGEDYYACTETNFITKINPETLETIKQVDLCNYISVNGATAHP HIESDGTVYNIGNCFGKNFTVAYNIIKIPPLKADKEDPINKSEVVVQFPCSDRFKPSYVH SFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNESMGVWLHVADKKRRKYFN NKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKRNAMKAP QPEVRRYVLPLTIDKVDTGRNLVTLPHTTATATLRSDETIWLEPEVLFSGPRQAFEFPQI NYQKFGGKPYTYAYGLGLNHFVPDKLCKMNVKTKEIWMWQEPDSYPSEPIFVSQPDALEE DDGVVLSVVVSPGAGQKPAYLLVLNAKDLSEIARAEVETNIPVTFHGLFKRS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Critical isomerohydrolase in the retinoid cycle involved in regeneration of 11-cis-retinal, the chromophore of rod and cone opsins. Catalyzes the cleavage and isomerization of all-trans-retinyl fatty acid esters to 11-cis-retinol which is further oxidized by 11-cis retinol dehydrogenase to 11-cis-retinal for use as visual chromophore. Essential for the production of 11-cis retinal for both rod and cone photoreceptors. Also capable of catalyzing the isomerization of lutein to meso-zeaxanthin an eye-specific carotenoid. The soluble form binds vitamin A (all-trans-retinol), making it available for LRAT processing to all-trans-retinyl ester. The membrane form, palmitoylated by LRAT, binds all-trans-retinyl esters, making them available for IMH (isomerohydrolase) processing to all-cis-retinol. The soluble form is regenerated by transferring its palmitoyl groups onto 11-cis-retinol, a reaction catalyzed by LRAT.
Gene References into Functions
  1. The present study describes identification of CU239, a novel non-retinoid inhibitor of RPE65, a key enzyme in the visual cycle. Our data demonstrated that CU239 selectively inhibited isomerase activity of RPE65, with IC50 of 6muM. PMID:29684583
  2. Study describes a mouse model of Leber's Congenital Amaurosis type 2 with mutation in Rpe65 gene. Functional and biochemical studies confirm that vitamin A metabolism and visual processing are disrupted in this model. PMID:27150101
  3. The loss of ERK1/2 activity resulted in a significant decrease in the level of RPE65 expression, a decrease in ocular retinoid levels concomitant with low visual function, and a rapid disorganization of RPE cells, ultimately leading to retinal degeneration. PMID:29038159
  4. these observations suggest that D477G acts as a dominant-negative mutant of RPE65 that delays chromophore regeneration. PMID:28041994
  5. The Leu450Met variant of RPE65 is expressed in C57BL/6 and in many genetically modified mice. It confers significant resistance to light induced retinal degeneration (LIRD). PMID:27768794
  6. Influx of T lymphocytes was associated with retinal pigment epithelium and choroidal thinning and diminished expression of RPE65 mRNA, an essential enzyme of the visual cycle. PMID:26392743
  7. the RPE65 protein expression was abnormal PMID:27116862
  8. These data also help define minimal requirements of chromophore for photoreceptor survival in vivo and may be useful in assessing a beneficial therapeutic dose for RPE65 gene therapy in humans. PMID:25972377
  9. properties of disease causing RPE65 with regard to molecular pathogenic mechanism PMID:24849605
  10. The rd12 lesion is in Rpe65. The rd12 mutant phenotype inherits in a semidominant manner. The effects of the mutant mRNA on visual function may result from inefficient binding to ribosomes for translation. PMID:24644049
  11. Despite the previously reported upregulation of Cspg5 during retinal degeneration in Rpe65/ mice, no protective effect or any involvement of Cspg5 in disease progression was identified. PMID:24265546
  12. To recapitulate this event in vivo, we examined tumor formation in NOG mice after subcutaneous injection of iPSCs with or without an iPSC-derived RPE sheet (2.5 x 10(5) RPE cells). PMID:23903667
  13. Cone-opsin trafficking defects were replicated in Rpe65-/- Rho-/- retina-retinal pigment epithelium cultures. PMID:23734084
  14. The Rpe65KO and tvrm148 mutations do not complement one another, proving that the tvrm148 mutation occurs in the Rpe65 locus and is the causative lesion driving visual function loss. PMID:23778877
  15. Aromatic residues in the substrate cleft of RPE65 protein govern retinol isomerization and modulate its progression. PMID:22745121
  16. a role for MYO7A in the translocation of RPE65 PMID:21493626
  17. Rpe65 deficiency may have many metabolic consequences in the underlying neuroretina. Glb1l3 was the only Glb-related member strongly downregulated in Rpe65(-/-) retinas before the onset and during progression of disease. PMID:21633714
  18. Mef2c was the only Mef2 member markedly downregulated during retinal degeneration in Rpe65(-/-) mice. PMID:21715356
  19. These results demonstrate that RPE65 within cones may be essential for the efficient regeneration of cone photopigments under bright-light conditions. PMID:21753017
  20. Gene therapy regenerates protein expression in cone photoreceptors in Rpe65(R91W/R91W) mice. PMID:21304899
  21. RPE65 is bound by Pyridinium bis-retinoid A2E, thus inhibiting the regeneration of 11-cis retinal, the chromophore of visual pigments - a unique mechanism by which A2E may impair vision in Stargardt disease. PMID:20876139
  22. oxidative stress during the visual cycle results in cleavage of RPE65 PMID:20510285
  23. FATP1 inhibits 11-cis retinol formation via interaction with the visual cycle retinoid isomerase RPE65 and lecithin:retinol acyltransferase PMID:20356843
  24. higly conserved protein; genes for mouse and human are conserved in overall structure. PMID:11740468
  25. Rpe65 specifically binds all-trans-retinyl palmitate but not 11-cis-retinyl palmitate by a spectral-shift assay. PMID:14532273
  26. RPE65 is not critical for generation of 9-cis-retinal in the eye PMID:14578454
  27. An allele encoding a leucine at amino acid 450(leu450) of the RPE65 protein is associated with greater sensitivity to light damage than as allele encoding methionine (met 450). PMID:15112105
  28. show that an amino acid variant in murine Rpe65is associated with reduced A2E accumulation and diminished tendency towards A2E/iso-A2E formation PMID:15277666
  29. Age-related changes in the basement membrane of the retinal pigment epithelium occur earlier in life and are more extensive in Rpe65 mutant mice. PMID:15378383
  30. As a chaperone, each RPE65 molecule can deliver retinyl ester to the isomerohydrolase of 11-cis-retinal at a rate of 10 molecules a minute PMID:16026160
  31. retinal degeneration was reduced in mice expressing the Rpe65(450Met) variant and that these mice retained more visual pigment rhodopsin than did transgenic mice expressing the Rpe65(450Leu) variant. PMID:16519667
  32. In rpe65 deficient mice, the level of photoreceptor degeneration is less than in the agouti animals, which have an increased pigment and decreased free opsin level. PMID:16553465
  33. Normal photoentrainment was lost in Rpe65(-/-);melanopsin(-/-) mice, and, instead, a diurnal phenotype was observed PMID:16788070
  34. results suggest that RPE65 defect triggers an overall remodeling of the neurosensitive retina that may, in turn, disrupt photoreceptor homeostasis and induce apoptosis signaling cascade toward retinal cell death. PMID:17012256
  35. By demonstrating that lentivirus-mediated Rpe65 gene transfer protects and restores the function of cones in the Rpe65(-/-) mouse, this study reinforces the therapeutic value of gene therapy for RPE65 deficiencies. PMID:17032058
  36. RPE65 has a role in rod and cone pigment regeneration PMID:17249562
  37. LRAT is not required for isomerase activity beyond synthesis of retinyl-ester substrate, and the association of Rpe65 with membranes is neither dependent upon LRAT nor the result of S-palmitoylation PMID:17504753
  38. Study found that in contrast to Rpe65 null mice, low but substantial levels of both RPE65 and 11-cis-retinal were present in R91W knock-in mice leading to a progressive loss of photoreceptor cells and retinal function. PMID:17933883
  39. Wildtype dog RPE65 is more active than wildtype mouse RPE65. The effect of Met at aa450 is more severe in mouse RPE65 than in dog. Effects of variation at residues 446 (K or R) modulate variation at aa450. PMID:17960118
  40. Lentiviral gene transfer-mediated cone vision restoration in Rpe65 knockout mice is reported. PMID:18188932
  41. retinylamine was the most potent and specific inhibitor of the retinoid cycle among the tested compounds and that it targets the retinoid isomerase, RPE65 PMID:18195010
  42. These data show that the Lrat-/- and Rpe65-/- mice are comparable models for studies of Leber congenital amaurosis and that the destructive cone opsin mistrafficking is caused by the lack of 11-cis retinal. PMID:18296659
  43. During retinal degeneration in Rpe65-/- mice, neuroglycan C(NGC) expression is induced in neural retina, but not in retinal pigment epithelium, where NGC is expressed at highest levels. PMID:19050768
  44. Knockout of the Rpe65 gene gave severely night-blind animals with lack of 11-cis retinoids in retina and excess of all-trans retinyl esters in the retinal pigment epithelium,consistent with blockade of the all-trans to 11-cis isomerization of retinoids. PMID:9843205

Show More

Hide All

Subcellular Location
Cytoplasm. Cell membrane; Lipid-anchor. Microsome membrane.
Protein Families
Carotenoid oxygenase family
Tissue Specificity
Retinal pigment epithelium specific.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1