DDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.4
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.
Gene References into Functions
LOX over-expression in vascular smooth muscle cells was associated with a change in the structure of collagen and elastin fibres; LOX could constitute a novel source of oxidative stress that might participate in elastin changes and contribute to vascular remodellingPMID:28624291
LOX up-regulation is associated with enhanced oxidative stress that promotes p38MAPK activation, elastin structural alterations, and vascular stiffness.PMID:28010122
These results suggest that LOX has the ability to induce RANKL expression on stromal cells; however, it fails to substitute for RANKL in osteoclastogenesis.PMID:27606829
UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells.PMID:28106301
Data show that LOX-PP enhances adipogenesis at least partially through inhibition of FGF-2 receptor signaling.PMID:28452589
Absence of lysyl oxidase (Lox) causes thoracic aortic aneurysms. The aortic mechanical behavior of Lox(-/-) mice is consistent with reduced elastin and collagen cross-linking but demonstrates vascular location-specific differences. Lox(-/-) aortas show upregulation of matrix remodeling genes and location-specific differential expression of other matrix and smooth muscle cell gene sets.PMID:28550176
Findings from this study indicate that preventing LOX overexpression may be protective against high glucose-induced apoptosis in retinal vascular cells associated with diabetic retinopathy.PMID:28538980
LOX family members contribute significantly to the detrimental effects of cardiac remodelling, highlighting LOX inhibition as a potential therapeutic strategy for post-infarction recoveryPMID:26260798
Findings suggest that the lysyl oxidase (LOX)-mediated organization of collagen fibers in the extracellular matrix is an important regulator of osteoblastogenesis.PMID:26497171
The data suggest a fibromodulin-modulated collagen cross-linking mechanism where fibromodulin binds to a specific part of the collagen domain and also forms a complex with lysyl oxidase, targeting the enzyme toward specific cross-linking sites.PMID:26893379
Data suggest of pharmacologic targeting of lysyl oxidase (LOX) pathway to inhibit liver fibrosis and promote its resolution.PMID:26700732
Cu chaperone function of Atox1 mediated through Cu transporter ATP7A is required for VEGF-induced angiogenesis via activation of Cu enzyme lysyl oxidase.PMID:26437801
CTR1, ATP7A, and lysyl oxidase were upregulated in the lung tissues and pulmonary arteries of mice with hypoxia-induced pulmonary hypertension and pulmonary arterial smooth muscle cells.PMID:24614111
Inhibition of tissue transglutaminase resulted in a reduced rate of compaction compared to controls during early remodeling (up to 2 days). In contrast, inhibition of lysyl oxidase did not alter the early compaction.PMID:25924936
decreased expression of cross-linking enzymes (LOXs) and increased expression of ECM-degrading proteinases (MMP-1, 2, 3) might be of great contribution to poor healing ability of PCL ligamentPMID:25416119
LOX is indispensable for the progression of BLM-induced experimental lung fibrosis by aggravating the inflammatory response and subsequent fibrosis process after lung injury.PMID:25348956
LOX and LOXL2 may play an important role in the pathogenesis of AMD. Targeting LOXL2 could have a broader efficacy than targeting LOX, by reducing angiogenesis and inflammation, as well as fibrosis.PMID:26258612
LOX plays a critical role in vascular remodellingPMID:24990180
LOX is a novel regulator of NFATc1-driven osteoclastogenesis, independent of RANK ligand, which disrupts normal bone homeostasis leading to the formation of focal pre-metastatic lesionsPMID:26017313
DDR2 binding and activation were disrupted by collagen glycation, pointing to a mechanism for the diminished levels of lysyl oxidase and consequently low lysyl oxidase-derived cross-links in diabetic bone.PMID:24120383
miR-29b down-regulates HSP47 and LOX expression.PMID:24650661
lysyl oxidase activity participates in primary tumor growth by directly impacting the senescence stability.PMID:24113189
Silencing of lysyl oxidase in BMP4-treated C3H10T1/2 cells induced a mesenchymal-epithelial transition (MET)-like response associated with the repression of mesenchymal markers, induction of epithelial markers and decreased cell migration.PMID:23395997
LOX expression is strongly upregulated in Staphylococcus aureus infections in vivo.PMID:23649089
Suggest a causal relationship between LOX downregulation and aortic stiffening in obesity.PMID:23413430
Stress urinary incontinence following vaginal trauma involves over-expression of LOX and decreased synthesis of extracellular matrix components or increased proteolysis in the urethra.PMID:22572217
Data show that lysyl oxidase LOX staining intensity was intermittent in the ligamentum flavum over from stages E15 to 2 years, and stages that stained intensely were E16 and E18, and P7 through P21.PMID:22685574
the lysyl oxidase (Lox) protein is degraded through lysosome and accumulated in the Vps18 deficient cerebellum but not in cerebral cortices.PMID:22699122
Lysyl oxidase activity is essential to generate optimal chemotactic sensitivity of cells to chemoattractants by oxidizing specific cell surface proteins, such as platetlet-derived growth factor receptor (PDGFR)-beta.PMID:21509606
These results indicate that proLOX could be processed by two different mechanisms producing two forms of active LOX.PMID:21591931
LOX-PP is shown to negatively regulate pro-oncogenic beta-catenin signaling in lung cancer cells.PMID:21690299
LOX is a potential mediator that couples mechanotransduction to oncogenic signaling by TGF-beta1 and measures capable of inactivating LOX function may prove effective in diminishing breast cancer progression stimulated by TGF-beta1.PMID:21532881
in vitro and in vivo data support a novel role for LOX in regulating MK expansion by PDGF-BB and suggest LOX as a new potential therapeutic target for myelofibrosisPMID:21665949
Data show that CA9, GLUT1 and LOX mRNA levels were equally and strongly correlated to hypoxic extent in FaDudd, and the same profile was observed for CA9 and GLUT1, but not LOX, in SCCVII tumors.PMID:21306648
LKB1 loss of function promotes lung cancer malignancy through remodeling of extracellular matrix microenvironment, and identify LOX as a potential target for disease treatment in lung cancer patients.PMID:20956321
Suggest that uric acid increases fibronectin synthesis both in vivo and in vitro via urate transporters through upregulation of lysyl oxidase expression.PMID:20484295
periostin supported BMP-1-mediated proteolytic activation of LOX on the extracellular matrix, which promoted collagen cross-linking.PMID:20181949
LOX has a novel function in resolving inflammation by reducing MCP-1 in abdominal aortic aneurysmPMID:19683237
Lysyl oxidase has a role in oxidizing basic fibroblast growth factor and inactivating its mitogenic potentialPMID:12461785
lysyl oxidase appears critical during embryogenesis for structural stability of the aorta and diaphragm and connective tissue developmentPMID:12473682
Lox expression is prominent during embryonic cardiovascular development.PMID:12524683
Anti-oncogenic effects of lysyl oxidase on ras-mediated transformation are due to its ability to inhibit signaling pathways that lead to activation of NF-kappa BPMID:12640111
FGF-2 autocrine pathway inhibits lysyl oxidase transcription in the tumorigenic-transformed RS485 cell line.PMID:12788924
The LOX expressed in the choroid plexus, blood vessel walls, brain matrix, and neurons of normal mice. And LOX gene expression was enhanced in the neurons of the spinal cord, brain stem, cortex, caudoputamen and cerebellum in mSOD1 mice.PMID:14741400
collagen deposition and lysyl oxidase are regulated by tumor necrosis factor-alpha in osteoblastsPMID:15138266
lysyl oxidase functions to inhibit ras-dependent cell transformationPMID:15277520
Results compare the immunohistochemical localization of lysyl oxidase and lysyl oxidase-like in various tissues from normal, young adult mice.PMID:15609098
the FN matrix may provide specific microenvironments to regulate LOX catalytic activityPMID:15843371
Show
More
Hide
All
Subcellular Location
Secreted. Secreted, extracellular space.
Protein Families
Lysyl oxidase family
Tissue Specificity
Expressed in aorta (at protein level). Expressed in embryonic, juvenil and adult aorta.