Home
Product
Protein
Recombinant Proteins
Recombinant Mouse Prostate stem cell antigen (Psca)

Recombinant Mouse Prostate stem cell antigen (Psca)

Baculovirus
Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

Psca

Uniprot NO.

P57096

Research Area

Others

Alternative Names

Psca; Prostate stem cell antigen

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

21-95aa

Target Protein Sequence

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

10.4kD

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May be involved in the regulation of cell proliferation.; May act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits nicotine-induced signaling probably implicating alpha-3:beta-2- or alpha-7-containing nAChRs.

Gene References into Functions

Increase in prostate stem cell antigen expression in prostatic hyperplasia induced by testosterone and 17beta-estradiol in C57BL mice PMID:26815912
This transgenic system helps define the range of cellular changes associated with altered expression of PSCA, shows that transcriptional control is a major component regulating PSCA levels. PMID:11752398
Sca-1-enriched prostate-regenerating cells possess multiple stem/progenitor cell properties PMID:15860580
PSCA may play a role in limiting prostate tumor progression in certain contexts, and deletion of PSCA may promote tumor migration and metastasis. PMID:18044730

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor.

Tissue Specificity

Predominantly expressed in prostate. Also found in spleen, liver, lung, prostate, kidney and testis. Expressed in brain cortex; expression is increased in transgenic mouse model of Alzheimer disease (at protein level).

Database Links

UNIGENE: Mm.46395

KEGG: mmu:72373

STRING: 10090.ENSMUSP00000023265

Promotions