Recombinant Mouse Neutrophil elastase (Elane)

Code: CSB-EP659740MO
Size:
20ug
20ug100ug1mg
US$256
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Elane protein
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Elane
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
Elastase-2;Leukocyte elastase
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
27-265aa
Target Protein Sequence
SEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWINSIIRSHNDHLLTHPKDREGRTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Medullasin modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis. Capable of killing E.coli; probably digests outer membrane protein A (ompA) in E.coli.
Gene References into Functions
  1. the impact of NE mutations that are typical of human congenital neutropenia in a murine model of in vitro and in vivo neutrophil differentiation PMID:27942017
  2. Levels of neutrophil elastase (NE) and the nuclear factors CCAAT/enhancer-binding protein alpha (C/EBPalpha) and growth factor-independent 1 (GFI-1) are elevated in hematopoietic stem and progenitor cells from high-fat diet (HFD)-fed mice, but mice lacking either NE or C/EBPalpha are resistant to HFD-induced myelopoiesis. PMID:28202548
  3. Sivelestat treatment significantly reduced the protein level, neutrophil count, neutrophil elastase activity in bronchoalveolar lavage fluid (BALF). PMID:28300553
  4. Serine protease required for resistance to microbial infection; contributes to pathogenessis in endotoxic shock PMID:10714686
  5. Neutrophils from neutrophil elastase-deficient mice show no defect in transendothelial migration PMID:11994507
  6. results of ultrasound studies using the elastase and AngII apoE in 4 biomechanical parameters: aneurysm diameter, aneurysm volume, circumferential cyclic strain, and blood flow velocity PMID:26064906
  7. Sirtinol is a novel HNE inhibitor and may have the potential for clinical application in the treatment of inflammatory lung diseases. PMID:25666548
  8. Increased ELANE activity was associated with development of autoimmune diabetes mellitus in NOD mice. PMID:25092677
  9. Neutrophil elastase is involved in the induction of microbicidal activities of neutrophils against Trypanosoma cruzi-infected macrophages. PMID:24599360
  10. contributes to clearance of Aspergillus fumigatus infections PMID:24054721
  11. In conclusion, sivelestat reduced radiationinduced lung injury in the mice by suppressing neutrophil elastase activity and excessive inflammatory reactions PMID:23404144
  12. Lung cancer promotion by inflammation is partly mediated by activation of the IL-8/CXCR2 pathway and subsequent recruitment of neutrophils and release of neutrophil elastase. PMID:24321240
  13. a neutrophil elastase inhibitor prevents bleomycin-induced pulmonary fibrosis in mice PMID:22441751
  14. During Pseudomonas aeruginosa infection, interleukin (IL)-1beta processing is dependent on neutrophil elastase and not NLRC4 or caspase-1. PMID:23024281
  15. Neutrophil elastase modulates cytokine expression: contribution to host defense against Pseudomonas aeruginosa-induced pneumonia. PMID:22927440
  16. NADPH oxidase in antimicrobial host defense against A. fumigatus and B. cepacia, whereas the proteases neutrophil elastase, cathepsin G, and lysosomal cysteine protease cathepsin C/ dipeptidyl peptidase I are dispensable PMID:22163282
  17. Cathepsin G and neutrophil elastase contribute to lung-protective immunity against mycobacterial infections in mice. PMID:22461690
  18. Neutrophil elastase cleaves the murine hemidesmosomal protein BP180/type XVII collagen and generates degradation products that modulate experimental bullous pemphigoid. PMID:21979170
  19. This is the first study showing a contribution of neutrophil-derived neutral serine proteases CG and NE to lung-protective immunity against focal pneumonia-inducing serotype 19 S. pneumoniae in mice. PMID:21911460
  20. The selective sensitivity of G913X Elane granulocytic cells to ER stress provides new and strong support for the unfolded protein response model of disease pathogenesis in severe congenital neutropenia. PMID:21285438
  21. neutrophil infiltration and neutrophil elastase (NE) activity are elevated in the chronic UVB-irradiated skin of hairless mice, and confirmed the involvement of NE in MMP activation PMID:20965700
  22. In the absence of a pathogen challenge, neutrophil-derived proteases and nucleosomes contribute to large vessel thrombosis, the main trigger of myocardial infarction and stroke. PMID:20676107
  23. Since NE is maximally produced in promyelocytes, this protease may play a role in APL pathogenesis by facilitating the leukemogenic potential of PML-RARalpha. PMID:14636558
  24. neutrophil elastase and cathepsin G are inhibited by PAI-1 mutants PMID:15131125
  25. Neutrophil elastase has a role in PML-retinoic acid receptor alpha activities in early myeloid cells PMID:15601827
  26. When challenged intraperitoneally, mice deficient in neutrophil elastase are markedly more susceptible to Klebsiella infection and death. PMID:15661916
  27. PECAM-1, alpha6 integrins and neutrophil elastase work together to mediate neutrophil transmigration PMID:15840647
  28. The results of the present study strongly suggest that neutrophil elastase may represent a common pathogenic link between emphysema and fibrosis. PMID:16045796
  29. Neutrophil elastase depends on serglycin proteoglycan for localization in granules. PMID:17272511
  30. This study describes for the first time a novel hierarchy among proteases whereby a serine protease NE up-regulates expression of MMPs and cathepsins. PMID:17442971
  31. Neutrophil elastase and proteinase 3 complexes have different interaction patterns with peptidic substrates. PMID:18023421
  32. Neutrophil elastase cleaves laminin-332 (laminin-5) generating peptides that are chemotactic for neutrophils. PMID:18178964
  33. required for neutrophil egression from the vasculature into the alveolar space; interfering with this process leads to neutrophil-related endothelial cell injury. PMID:18276796
  34. neutrophil elastase might decrease the pulmonary endothelial production of prostacyclin by inhibiting endothelial NO production PMID:18323746
  35. PR3 and neutrophil elastase enhance neutrophil-dependent inflammation by eliminating the local antiinflammatory activity of progranulin. Our results support the use of serine protease inhibitors as antiinflammatory agents. PMID:18568075
  36. Neutrophil elastase (NE) degrades the major outer membrane protein F (OmpF); a targeted deficiency in NE negates its antibacterial role in vitro and in a Pseudomonas aeruginosa pneumonia model. PMID:18802098
  37. during acute peritoneal inflammation, NE expression and activity increase gradually, facilitating leukocyte influx. PMID:19088179
  38. Evidence for a role of Ela2 in antimicrobial immunity and endotoxic shock PMID:10714686
  39. Evidence for a role of neutrophil elastase in bleomycin-induced fibrosis PMID:11451907

Show More

Hide All

Protein Families
Peptidase S1 family, Elastase subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products