Recombinant Mouse NAD-dependent protein deacetylase sirtuin-6 (Sirt6)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Sirt6
Uniprot NO.
Alternative Names
Sirt6; Sir2l6; NAD-dependent protein deacetylase sirtuin-6; EC 2.3.1.286; Regulatory protein SIR2 homolog 6; SIR2-like protein 6
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
1-334
Target Protein Sequence
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLMWQSSSVVFHTGAGISTASG IPDFRGPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHV RSGFPRDKLAELHGNMFVEECPKCKTQYVRDTVVGTMGLKATGRLCTVAKTRGLRACRGE LRDTILDWEDSLPDRDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLVIVN LQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPP VHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
NAD-dependent protein deacetylase involved in various processes including telomere maintenance and gene expression, and consequently has roles in genomic stability, cell senescence and apoptosis. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. May also be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Deacetylation of nucleosomes interferes with RELA binding to target DNA. Acts as a corepressor of the transcription factor Hif1a to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for normal IGF1 serum levels and normal glucose homeostasis. Regulates the production of TNF protein. Has a role in the regulation of life span in male mice, but not in female mice.
Gene References into Functions
  1. therapeutic effect on periapical lesions through suppression of CCL2 synthesis PMID:28039864
  2. Study provides evidence that sirtuin 6 (SIRT6) can protect the brain from cerebral cerebral ischemia/reperfusion injury by suppressing oxidative stress via nuclear factor (erythroid-derived 2)-like 2 activation. Thus, SIRT6 may serve as a potential therapeutic target for ischemic stroke. PMID:28951325
  3. SIRT6 knockout cells resist apoptosis initiation but not progression. PMID:28856570
  4. Sirt6 in pancreatic beta cells deacetylates FoxO1 and subsequently increases the expression of Pdx1 and Glut2 to maintain the glucose-sensing ability of pancreatic beta cells and systemic glucose tolerance. PMID:27457971
  5. SIRT6 interacts with and promotes phospho-ATF2 binding to the PGC-1alpha gene promoter to activate its expression. The present study reveals a critical role for SIRT6 in regulating thermogenesis of fat. PMID:28723567
  6. Moreover, the authors showed that Sirt6, induced by RANKL-dependent NFATc1 expression, forms a complex with B lymphocyte-induced maturation protein-1 (Blimp1) to negatively regulate expression of anti-osteoclastogenic gene such as Mafb. PMID:27189179
  7. Collectively, our findings uncover the autophagy modulated by SIRT6 may be a proinflammatory mechanism for amyloid-beta induced RPE dysfunction. PMID:29402409
  8. Sirt6 inhibits Notch1 and Notch4 transcription by deacetylating histone H3K9. PMID:28871079
  9. Sirt6 is downregulated in induced pluripotent stem cells from old mice. PMID:28329681
  10. SIRT6 and its downstream signaling could be targeted in Alzheimer's disease and age-related neurodegeneration. PMID:28355558
  11. These findings reveal a crucial role of SIRT6 in adipogenesis and provide potential therapeutic targets for obesity. PMID:28355567
  12. Global and endothelium-specific SIRT6 knockout mice exhibited impaired endothelium-dependent vasorelaxation. Moreover, SIRT6(+/-) haploinsufficient mice fed a high-fat diet (HFD) also displayed impaired endothelium-dependent vasorelaxation. Importantly, SIRT6(+/-); ApoE(-/-) mice after HFD feeding had exacerbated atherosclerotic lesion development, concurrent with increased expression of proinflammatory cytokine VCAM-1. PMID:27249230
  13. these data provide compelling evidence that Sirt6 is important for podocyte homeostasis and maintenance of glomerular function PMID:28351995
  14. The mice with SIRT6 deficiency in muscle displayed impaired glucose homeostasis and insulin sensitivity, attenuated whole body energy expenditure, and weakened exercise performance. Results from both gain- and loss-of-function experiments identify SIRT6 as a physiological regulator of muscle mitochondrial function. PMID:28765271
  15. Study investigated the involvement of SIRT6 in adult hippocampal neurogenesis. Mice over-expressing Sirt6 exhibit increased numbers of young neurons and decreased numbers of mature neurons, without affecting glial differentiation. PMID:28644902
  16. Sirt6 deletion in macrophages promoted the activation of nuclear factor-kappaB (NF-kappaB) and endogenous production of interleukin-6, which led to STAT3 activation and the positive feedback circuits for NF-kappaB stimulation; this cross talk expedited an M1 polarization PMID:28607107
  17. These data suggest that the function of SIRT6 in the Fabp4-Cre-expressing cells in addition to mature adipocytes plays a critical role in body weight maintenance and metabolic homeostasis. PMID:28385723
  18. a physiological defects in adult SIRT6-/- mice PMID:28448551
  19. In mouse retinae lacking Sirt6, effectors of glycolytic flux were dramatically increased, leading to upregulation of key intermediates in glycolysis, TCA cycle, and glutaminolysis. PMID:27841758
  20. It has been demonstrated that Sirt6 plays a role in tooth root formation, and it was confirmed that SIRT6 is necessary for dental mesenchymal cells differentiation as well as for the development of the tooth root and for eventual tooth eruption. PMID:28355287
  21. Fat-specific Sirt6 knockout (FKO) sensitized mice to high-fat diet-induced obesity, which was attributed to adipocyte hypertrophy rather than adipocyte hyperplasia. Fat-specific Sirt6 KO also increased inflammation in the adipose tissue, which may have contributed to insulin resistance in high-fat diet-fed FKO mice. PMID:28250020
  22. SIRT6 is a primary negative regulation factor in endothelial dysfunction and atherosclerosis development. PMID:26924042
  23. Data suggest that expression of Sirt6 in pancreatic beta cells protects against dysfunction (loss of hyperglycemia-induced insulin secretion) and apoptosis; Sirt6 appears to protect beta cells against the oxidative stress of diabetes type 2 and of cellular aging. PMID:27601447
  24. SIRT6, a sirtuin with established tumor suppressor function, regulates the lysine fatty acylation of R-Ras2. PMID:28406396
  25. data indicate that distinct activities of SIRT6 regulate different pathways and that the G60A mutant is a useful tool to study the contribution of defatty-acylase activity to SIRT6's various functions PMID:27322069
  26. The critical role of SIRT6 on aging and inflammation. PMID:26940461
  27. The SIRT6 regulates HSC homeostasis through the transcriptional repression of Wnt target genes. Sirt6 deletion promoted HSC proliferation through aberrant activation of Wnt signaling. PMID:27058938
  28. Sirt6 plays a crucial role in dendritic cell differentiation and function and reduced Sirt6 activity may contribute to immunosenescence. PMID:26761436
  29. up-regulates AMP/ATP and then activates the AMPK-FoxO3alpha axis and further initiates the downstream antioxidant-encoding gene expression, thereby decreasing cellular levels of oxidative stress and mediating cardioprotection in the ischemic heart PMID:26786260
  30. SIRT6 is important for glucose-stimulated insulin secretion from pancreatic beta cells and activation of SIRT6 may be useful to improve insulin secretion in diabetes PMID:26471901
  31. These data strongly suggest that overexpression of Sirt6 can prevent osteoarthritis development by reducing both the inflammatory response and chondrocytes senescence. PMID:26639398
  32. Sirt6 depletion causes spindle defects and chromosome misalignment during meiosis of mouse oocyte PMID:26481302
  33. In SIRT6-deficient mice there is impaired bone remodeling leading to osteopenia. PMID:26189760
  34. SIRT6/NF-kappaB signaling axis in ginsenoside Rg1-delayed hematopoietic stem/progenitor cell senescence. PMID:26191269
  35. Data showed the expression levels of SIRT1, SIRT3, and SIRT6 were decreased in the ovaries of aged mice and mice treated with chemotherapy, but increased in mice treated to caloric restriction suggesting these genes are closely related to ovarian reserve. PMID:26403315
  36. Sodium sulfide protected brain endothelial cells against simulated ischemic injury through SIRT6-dependent mechanisms. PMID:25543188
  37. SIRT1 localizes to the promoters of several aberrantly silenced tumor suppressor genes whose DNA is hypermethylated PMID:26775341
  38. Sirt6 has key roles in the relationship among ageing, metabolic syndrome, and osteoarthritis PMID:26362183
  39. Overall these results suggest that SIRT6 may play a role in synaptic function and neuronal maturation and PMID:25366464
  40. Studied the effect of icariin (ICA) on cardiac aging through its effects on the SIRT6 enzyme and on the NF-kappaB pathway. PMID:25688369
  41. Our results identify SIRT6 as a critical modulator of retinal function, likely through its effects on chromatin. PMID:24896097
  42. SIRT6 represses LINE1 retrotransposons by ribosylating KAP1 but this repression fails with stress and age. PMID:25247314
  43. SIRT6 functions as a chromatin regulator safeguarding the balance between pluripotency and differentiation through Tet-mediated production of 5-hydroxymethylcytosine. PMID:25915124
  44. Mouse sirtuin 6 immunohistochemical changes in the early stages of type II Diabetes mellitus. PMID:24063863
  45. Over-expression of SIRT6 protects cardiomyocytes against hypoxia. PMID:25066211
  46. SIRT6 regulates the cigarette smoke-induced signalling in rheumatoid arthritis synovial fibroblasts PMID:24638860
  47. Sirt6 regulates postnatal growth plate differentiation and proliferation via Ihh signaling. PMID:24149372
  48. Our findings uncover a novel, evolutionary conserved function of SIRT6 in the maintenance of stress granules in response to stress. PMID:24013546
  49. In normal aging cell metabolism is reduced, in the diabetic mice a compensatory mechanism may elevate Sirt1 and Sirt6 levels. PMID:23761075
  50. CHIP noncanonically ubiquitinates SirT6 at K170, which stabilizes SirT6 and prevents SirT6 canonical ubiquitination by other ubiquitin ligases. PMID:24043303

Show More

Hide All

Subcellular Location
Nucleus. Note=Predominantly nuclear. Associated with chromatin.
Protein Families
Sirtuin family, Class IV subfamily
Tissue Specificity
Highest levels are found in muscle, thymus, spleen, brain and heart (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1