Recombinant Mouse Dicarboxylate carrier Ucp2 (Ucp2)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Ucp2
Uniprot NO.
Alternative Names
Ucp2; Slc25a8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8; UCPH
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
1-309
Target Protein Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYR GVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTS PNVARNAIVNCAELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA AYQSREAPF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
Gene References into Functions
  1. UCP2 regulates daily rhythms of insulin secretion in MIN6 cells and isolated islets from male mice. PMID:28702331
  2. Study provides evidence that UCP2 plays a protecting role against LPS by regulating the balance between autophagy and apoptosis of cardiomyocytes, and by which mechanisms, it may contribute to homeostasis of cardiac function and cardiomyocytes activity. PMID:29547569
  3. UCP2 inhibits myointimal hyperplasia after vascular injury, probably through suppressing nuclear factor-kappaB-dependent smooth muscle cell proliferation and migration. PMID:29025747
  4. Upregulation of UCP2 conferred protective effects to the stressed beta-cell through mechanisms not directly associated with superoxide production. PMID:28755631
  5. UCP2-dependent modulations have a major impact on cardiac electrophysiology. PMID:28370799
  6. UCP2 regulates embryonic neurogenesis through reactive oxygen species-mediated Yap alternation, thus shedding new sight on mitochondrial metabolism involved in embryonic neurogenesis. PMID:28276603
  7. Data demonstrate that UCP2 controls pancreas development through the ROS-AKT signaling pathway. PMID:29079704
  8. UCP2 has two glycine-rich motifs, motif 1: EGIRGLWKG (170-178) and a Walker A-like motif 2: EGPRAFYKG (264-272). These motifs seem to be important for the function of UCP2. UCP2/K177E- or UCP2/G174L-expressed cells did not induce enlarged cell shapes. UCP2/K177E and UCP2/G174L produced functional incompetence of the glycine-rich motif 1. Senescent-like cells significantly decreased the mitochondrial membrane potentials. PMID:26864036
  9. our findings reveal that UCP2 regulates inflammation responses in astrocytes and plays an important role in the pathogenesis of depression and that UCP2 may be a promising therapeutic target for depression. PMID:27566281
  10. attenuates renal ischemia-reperfusion injury, probably by reducing cell apoptosis through protection of autophagy PMID:28424210
  11. UCP-2 prevents angiotensin-II-induced abdominal aortic aneurysm in apolipoprotein E-knockout mice via antioxidant and antiapoptotic activities. PMID:28683125
  12. This study demonstrating a FABP4-UCP2 axis with the potential to modulate the microglial inflammatory response. PMID:28214555
  13. The miR-133a-UCP2 pathway participates in inflammatory bowel disease (IBD) by altering downstream inflammation, oxidative stress and markers of energy metabolism, which provides novel clues and potential therapeutic targets for IBD. PMID:28104982
  14. PPARgamma inhibited PDGF-BB-induced ROS in VSMCs by upregulating UCP2 expression. PMID:27144886
  15. these data offer a novel pathway whereby FABP4/aP2 regulates macrophage redox signaling and inflammasome activation via control of UCP2 expression. PMID:27795298
  16. Ucp2 affects glutathione metabolism by regulating hepatic efflux of glutathione. Nrf2 deficiency may not aggravate oxidative stress in Ucp2-deficient mice. PMID:27453341
  17. Induction of autophagy by SCFAs required PPARgamma stimulation of Uncoupling Protein 2 (UCP2) expression that was associated with reduced intracellular ATP levels and activation of PRKAA1/AMPK (protein kinase, AMP-activated, alpha 1 catalytic subunit). In addition, elimination of gut flora by chronic antibiotic treatment diminished basal hepatic autophagy in mice suggesting that gut microbiota can regulate hepatic auto... PMID:27773823
  18. UCP2 induces protective effects on ROS and ATP levels during aging. Additionally, the results suggest an imbalance in hematopoiesis because of the lack of UCP2. PMID:27544660
  19. Intriguingly, on the molecular level this acceleration in aging predominantly is accompanied by increased levels of circulating IGF-1 in Ucp2(-/-) mice, hinting at a crosstalk between UCP2 and the classical Insulin/IGF-1 signaling aging pathway. PMID:27364833
  20. PPARbeta/PPARgamma activation restored the LPS-induced endothelial dysfunction by upregulation of UCP2, with the subsequent alleviation of ER stress and NADPH oxidase activity, thus reducing intracellular reactive oxygen species production and increasing nitric oxide bioavailability. PMID:27179975
  21. Apart from their slower growth, pancreatic stellate cells of UCP2-/- mice displayed no functional abnormalities. PMID:27919855
  22. In the brains of UCP2-knockout mice, there was a decrease in glutamate, glutamine and GABA. PMID:27401256
  23. Loss of UCP2 impairs cold-induced non-shivering thermogenesis by promoting a shift toward glucose utilization in brown adipose tissue. PMID:28130074
  24. Increased expression of UCP2 significantly reduced apoptosis during the critical developmental period resulting in elevated numbers of retinal ganglion cells in the adult. PMID:26846222
  25. Study shows that mitochondrial location controlled by UCP2 is relevant for adaptive responses of neurons in cortical and hippocampal neurons and are relevant to perinatal hypoxia-triggered circuit adaptations PMID:26777666
  26. Study shows that glucose load results in mitochondrial fission and reduced reactive oxygen species in ventromedial nucleus of the hypothalamus neurons mediated by dynamin-related peptide 1 (DRP1) under the control of uncoupling protein 2 (UCP2). PMID:26919426
  27. UCP2 modulating role in mitochondrial calcium uptake PMID:26849136
  28. Blocking UCP2 expression attenuates cardiac hypertrophy induced by pressure overload PMID:26196155
  29. UCP2 knockout suppresses mouse skin carcinogenesis. PMID:25784177
  30. A newly identified functional variant (rs1626521) in UCP-3 affects postprandial gastric functions and satiety and may contribute to weight gain and alter human mitochondrial function. PMID:25755013
  31. while the lack of UCP2 has no acute effect on body temperature, UCP2 may inhibit rapid improvements in defense against cold, in contrast to UCP1, whose main function is to promote thermogenesis. PMID:24952267
  32. high UCP2 levels allow better utilization of fatty acid oxidation resulting in a beneficial effect on mitochondrial function in heart, postponing systemic lactic acidosis and resulting in longer lifespan in these mice. PMID:24945157
  33. Results suggest that hippocampal UCP2 is essential for cognitive function and the resistance to anxiety of mice, but not required for the beneficial effects of exercise PMID:25003714
  34. Free fatty acid recognizes UCP2 at a peripheral site via electrostatic interaction. Flipping ionized fatty acid by UCP2 is required for UCP2-mediated H+ transport in mitochondria. PMID:25127353
  35. long-term exposure to CT-1-CP could lead to the alteration in the expression of sarcomeric alpha-actin, alpha-actinin and mitochondrial UCP2. PMID:25480572
  36. Therefore, SET overexpression in HEK293 cells promotes mitochondrial fission and reduces autophagic flux in apparent association with up-regulation of UCP2 and UCP3. PMID:25656576
  37. The FABP-FFA equilibrium controls UCP2 expression. PMID:25582199
  38. UCP2 regulates the NLRP3 inflammasome by inducing the lipid synthesis pathway in macrophages. PMID:25574840
  39. In ApoE-knockout mice, there was a progressive reduction of UCP-2 levels and an increase in vascular damage. PMID:25077985
  40. Knock-out of Ucp2 exacerbated salt-induced cardiovascular and renal remodeling and enhanced oxidative stress. PMID:24833471
  41. UCP2 may act as a powerful influence on hepatic regeneration and cell death in the steatotic liver. PMID:24320727
  42. L. donovani infection resulted in degradation of USF1 thereby facilitating SREBP2 binding which in turn assisted in the association of Sp1 with the promoter ultimately culminating in elevated transcription of UCP2. PMID:24417972
  43. UCP2 is present in cells with highly proliferative potential, which have a glycolytic type of metabolism as a common feature, whereas UCP4 is strongly associated with non-proliferative highly differentiated neuronal cells PMID:24523901
  44. Mitochondrial retrograde signaling mediated by UCP2 inhibits cancer cell proliferation and tumorigenesis. PMID:24853548
  45. miR-30e/UCP2 axis has an important role in mediating TGF-beta1-induced epithelial-mesenchymal transition and kidney fibrosis. PMID:23515048
  46. Induction of UCP2 in pulmonary macrophages is an early response to hyperoxia-associated lung injury. PMID:23905971
  47. Mitochondrial UCP2 plays a critical role in protecting splenocytes from oxidative stress-induced apoptosis during pathogen activation. PMID:24291389
  48. TRPV1 activation might protect against hyperglycemia-induced endothelial dysfunction through a mechanism involving the PKA/UCP2 pathway. PMID:23607427
  49. UCP2 is upregulated in the absence of NLRP3 and ASC. PMID:23988448
  50. Increased mitochondrial membrane potential causes vascular remodeling in UCP2-deficient mice, partially via increased production of reactive oxygen species. PMID:23590303

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Highest in white adipose tissue, also detected in brown adipose tissue, heart and kidney. 4-6 times higher levels are detected in ob/ob and db/db mice.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1