Recombinant Mouse Methylcytosine dioxygenase TET2 (Tet2), partial

Code: CSB-EP678395MO
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: N-terminal 6xHis-KSI-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Tet2
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Tet2
Uniprot NO.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Tet2; Kiaa1546Methylcytosine dioxygenase TET2; EC 1.14.11.n2; Protein Ayu17-449
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1810-1912aa
Target Protein Sequence
RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.0 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP678395MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tet2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP678395MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tet2.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in active DNA demethylation. Has a preference for 5-hydroxymethylcytosine in CpG motifs. Also mediates subsequent conversion of 5hmC into 5-formylcytosine (5fC), and conversion of 5fC to 5-carboxylcytosine (5caC). Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT.
Gene References into Functions
  1. These results highlight the critical role of TET2 in the maintenance of BMSC functions and osteoblast differentiation and provide evidence that dysregulation of epigenetic modifiers in BMSCs contributes to the progression of myeloid malignancies. PMID:29290626
  2. Tet2/Nras double-mutant leukemia showed preferential sensitivity to MAPK kinase (MEK) inhibition in both mouse model and patient samples PMID:29275866
  3. Results indicate that tet oncogene 1 protein (Tet1) and tet oncogene 2 protein (Tet2) play a critical role in maintaining bone marrow MSCs (BMMSCs) and bone homeostasis through demethylation of P2X7 purinoceptor (P2rX7) to control exosome and miRNA release. PMID:29858571
  4. RHOA G17V expression together with Tet2 loss resulted in development of angioimmunoblastic T cell lymphoma in mice PMID:29398449
  5. findings demonstrate the requirement for microbial-dependent inflammation in the development of pre-leukaemic myeloproliferation (PMP) and provide a mechanistic basis for the variation in PMP penetrance observed in Tet2(-/-) mice; this study will prompt new lines of investigation that may profoundly affect the prevention and management of haematopoietic malignancies PMID:29769727
  6. Tet2-/- mice develop spontaneous myeloid, T- and B-cell malignancies after long latencies with higher mutation frequencies at genomic sites that gained 5-hydroxymethylcytosine, where Tet2 normally binds. PMID:28440315
  7. these results indicate that Tet2 is involved in myoblast differentiation through promoting DNA demethylation and myogenic gene expression. PMID:28272491
  8. this is the first evidence to suggest that TET2 mutations promote clonal dominance with aging by conferring TNFalpha resistance to sensitive bone marrow progenitors while also propagating such an inflammatory environment. PMID:29195897
  9. Suggest a role for TET2 in the pathogenesis of psoriasiform dermatitis. PMID:29542811
  10. TET2 plays an important role in the pathogenesis of diabetic nephropathy by activating TGFbeta1 expression through demethylation of CpG islands in the TGFbeta1 regulatory region PMID:29705354
  11. study reveals a previously unknown regulatory role of Tet2 at the epitranscriptomic level, promoting myelopoiesis during infection in the mammalian system by decreasing 5-mCs in mRNAs; moreover, the inhibitory function of cytosine methylation on double-stranded RNA formation and Adar1 binding in mRNA reveals its new physiological role in the mammalian system PMID:29364877
  12. This work revealed a critical role of TET2-mediated DNA demethylation against oxidative stress, and provided the molecular mechanisms underlying the epigenetic regulation of iron homeostasis in response to stress erythropoiesis. PMID:28697999
  13. Iron(II)/alpha-Ketoglutarate-Dependent Catalytic Domains of the TET Enzymes PMID:27362828
  14. TET2 has the effect of inhibiting LPS-induced macrophage activation and plays an inhibitory role in macrophage M1 and M2 polarization. PMID:29089070
  15. TET1 and TET2 play an important role in the proliferation of neural stem cells in the adult mouse brain. PMID:27778125
  16. we identified that TET2 was downregulated during the pathogenesis of atherosclerosis. The downregulation of TET2 promotes the methylation of the Beclin 1 promoter, leading to endothelial cell autophagy, impaired autophagic flux, and inflammatory factor upregulation. PMID:27821816
  17. These findings suggest that the catalytic and scaffolding activities of TDG are essential for retinoic acid-dependent gene expression and provide important insights into the mechanisms underlying targeting of TET-TDG complexes. PMID:28538185
  18. TET2 requires its catalytic activity in hematopoietic stem/progenitor cells to exert its myeloid malignancy-suppressive function PMID:27003514
  19. this article demonstrates that TET2 regulates CD8+ T cell differentiation PMID:29150566
  20. TET proteins, particularly TET2, were required for adipogenesis by modulating DNA methylation at the Ppargamma locus, subsequently by inducing Ppargamma gene expression. PMID:28100914
  21. Tet methylcytosine dioxygenase 2 (TET2) was the most highly expressed Tet enzyme in murine macrophage (MPhi) differentiation. PMID:28826859
  22. in the absence of TET2, mast cell differentiation is under the control of compensatory mechanisms mediated by other TET family members, while proliferation is strictly dependent on TET2 expression. PMID:27160912
  23. ablation of Tet2 in myeloid cells suppresses melanoma growth in vivo and shifted the immunosuppressive gene expression program in tumor-associated macrophages to a proinflammatory one PMID:28813659
  24. These results support the hypothesis that somatic TET2 mutations in blood cells play a causal role in atherosclerosis. PMID:28104796
  25. Loss of TET2 expression is associated with development of malignancy. PMID:27428748
  26. confirm the transformation potential of DNMT3A(R882H) Tet2(-/-) progenitors and represent the first cooperative model in mice involving Tet2 inactivation driving lymphoid malignancies PMID:26876596
  27. indicate that AID and TET2 share common effects on myeloid and erythroid lineage differentiation, however, their role is nonredundant in regulating HSC self-renewal and in myeloid transformation. PMID:28077417
  28. the results showed that low shear stress downregulated endothelial cell autophagy by impaired TET2 expression, which might contribute to the atherogenic process. PMID:26493943
  29. Zfp281 interacts with Tet1, but not Tet2, and its direct transcriptional target, miR-302/367, to negatively regulate Tet2 expression to establish and maintain primed pluripotency. PMID:27345836
  30. tet2 activity in GnRH neurons has influence over the neuroendocrine control of male reproductive function PMID:27384303
  31. Our data implicate TET enzymes ( TET1 and TET2 )in the evolutionary dynamics of TEs, both in the context of exaptation processes and of retrotransposition control. The dual role of TET action on LINE-1s may reflect the evolutionary battle between TEs and the host PMID:27863519
  32. this study demonstrates the critical role of TET proteins in regulating the crosstalk between two key epigenetic mechanisms. PMID:27288448
  33. The data suggest that TET2 activity and the levels of 5-hydroxymethylcytosine and its derivatives should be tightly controlled to avoid genetic and chromosomal instabilities. PMID:27289557
  34. TET2 plays a role in the iron and heme metabolism in erythroblasts. PMID:28167288
  35. the effects of vitamin C inhibiting the apo(a) expression were attenuated by ELK1siRNA and Tet2siRNA. These results suggested vitamin C down-regulate apo(a) expression via Tet2-dependent DNA demethylation in HepG2 cells PMID:28192139
  36. Reprogramming of spermatogonial stem cells from Tet1 and Tet2 double knockout mice however lacked demethylation of H19 imprinting control regions. PMID:26328763
  37. The critical roles of TET1/2 individually. PMID:26586431
  38. Tet2 was responsible for increase in 5-hydroxymethylcytosine abundance after ischemic injury. PMID:26231219
  39. These results uncover the hypermethylation of DNA methylation canyons as the genomic key feature of Tet1/Tet2 double-knockout mouse embryonic fibroblasts. PMID:26598602
  40. our results indicate that neuronal TET2 is positively involved in the regulation of cell survival. PMID:26378518
  41. UNG might be involved in Tet-mediated DNA demethylation. PMID:26620559
  42. Findings indicate a novel type of hematological malignancy induced by tet oncogene 2 protein (Tet2) loss. PMID:24844363
  43. Both TET1 and TET2 are required for the repression of embryonic stem cells differentiation by PRDM14. PMID:26325469
  44. reduced expression leads to Foxp3 hypermethylation and impairment of Treg-cell-associated immune homeostasis PMID:26275994
  45. mechanistic evidence for the gene-specific transcription repression activity of Tet2 via histone deacetylation and for the prevention of constant transcription activation at the chromatin level for resolving inflammation PMID:26287468
  46. These epigenetic changes, seen in Tet2 insufficiency-triggered lymphoma, possibly contributed to predated outgrowth of Tfh-like cells and subsequent lymphomagenesis. PMID:25501021
  47. SIRT6 functions as a chromatin regulator safeguarding the balance between pluripotency and differentiation through Tet-mediated production of 5-hydroxymethylcytosine. PMID:25915124
  48. effect of Tet2 loss in preleukemic hematopoietic cells is progressive and widespread DNA hypermethylation affecting up to 25% of active enhancer elements. PMID:25886910
  49. Data indicate the cooperation between receptor tyrosine kinase KIT D816V mutation and loss of function of tet oncogene 2 (TET2) in mast cell transformation in systemic mastocytosis (SM). PMID:24788138
  50. Tet2 promotes DNA demethylation and activation of cytokine gene expression in T cells. PMID:25862091

Show More

Hide All

Protein Families
TET family
Tissue Specificity
Highly expressed in the brain, kidney, heart, lung, muscle and stomach. Present in embryonic stem cells (ES cells).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products