Recombinant Mouse Mesothelin (Msln), partial

Code: 015044MO

Rate （N/A）
Review （0）

Size:

50μg100μg500μg1mg(1mg*1 or 500ug*2)

Pls inquire

Quantity:

Express system: Baculovirus

Species: Mus musculus (Mouse)

Tag Info: N-terminal His-tagged and C-terminal Myc-tagged/N-terminal His-tagged/Tag-Free

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Msln

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Msln

Uniprot NO.

Q61468

Species

Mus musculus (Mouse)

Source

Baculovirus

Expression Region

298-600aa

Target Protein Sequence

DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Partial

Tag Info

N-terminal His-tagged and C-terminal Myc-tagged/N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Membrane-anchored forms may play a role in cellular adhesion.; Megakaryocyte-potentiating factor (MPF) may potentiate megakaryocyte colony formation.

Gene References into Functions

our findings show that Sulf-1 is an important tumor suppressor gene in hepatocellular carcinoma (HCC), and its over expression downregulates Msln and results in a decrease in HCC cell proliferation, migration, invasion, and lymphatic metastasis. PMID:27626699
Mesothelin/mucin 16 signaling in activated portal fibroblasts regulates cholestatic liver fibrosis.( PMID:28287406
Results show that mouse mesothelin is similar to human mesothelin. Its stable overexpression in a pancreatic cancer cell line did not increase cell proliferation, suggesting that mesothelin is not necessarily a tumor progression factor. PMID:26931187
MSLN has an important role in the growth of lung cancer cells in vivo raising the possibility that inactivation of MPF may be a useful treatment for lung and other MSLN expressing cancers. PMID:25118887
The mesothelin expression promotes resistance to certain chemotherapy drugs such as TNF-alpha, paclitaxel, and a combination of platinum and cyclophosphamide. PMID:22721387
Mesothelin overexpression promotes mesothelioma cell invasion and MMP-9 secretion. PMID:22371455
Data show that mesothelin is a potential target in reducing resistance to cytotoxic drugs, and mesothelin-treated cells revealed rapid tyrosine phosphorylation of the p85 subunit of PI3K. PMID:19747165
binding of membrane-bound mesothelin to ovarian cancer antigen CA125 mediates heterotypic cell adhesion PMID:14676194