MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Trx-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway. May act as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. Suppresses cell proliferation and tumorigenesis by inhibiting the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. Plays a role in lens development and is required for complete fiber cell terminal differentiation, maintenance of cell polarity and separation of the lens vesicle from the corneal epithelium.
Gene References into Functions
Results demonstrate that loss of merlin function in Schwann Cells (SCs) leads to increased endoneurial space and ultrastructural myelin alterations in the sciatic nerve before and after injury. Loss of merlin function in SCs delays neural recovery following injury. Nevertheless, there were no significant functional or electrophysiological differences in neural regeneration attributable to Nf2 mutation in SCs.PMID:29408605
Data indicate an essential role for NF2 and the Hippo pathway in regulation of branching morphogenesis in the mammalian kidney.PMID:27480037
Loss of Nf2 causes hyperplasia and ocular abnormalities.PMID:29249622
studies suggest that NF2 normally limits biliary morphogenesis by coordinating lumen expansion and cell architecture. This work provides fundamental insight into how biliary fate and tubulogenesis are coordinated during development and will guide analyses of disease-associated and experimentally induced biliary pathologies.PMID:29712669
Data show that early Smarcb1 loss causes rhabdoid tumors whereas loss at later stages combined with Nf2 gene inactivation causes shwannomas.PMID:28824165
Rho attenuates the interaction between Amot and Nf2 by binding to the coiled-coil domain of Amot.PMID:28947533
co-deletion of Rac1 with Nf2 blocks tumor initiation but paradoxically exacerbates hepatomegaly induced by Nf2 loss, which can be suppressed either by treatment with pro-oxidants or by co-deletion of Yap.PMID:27818180
Merlin controls the repair capacity of Schwann cells after injury by regulating Hippo/YAP signaling activity.PMID:28137778
NF2 is activated by oxidative stress in cardiomyocytes and myocardium and facilitates apoptosis.PMID:27402866
loss of axonal contact following nerve injury results in merlin phosphorylation leading to increased p75(NTR) expression.PMID:26057084
Loss of Nf2 and Cdkn2a/b have synergistic effects with PDGF-B overexpression promoting meningioma malignant transformation.PMID:26418719
Merlin 1 and 2 act as tumor suppressors and are required for optimal sperm maturationPMID:26258444
Together our results uncover miRNAs as yet another negative mechanism controlling Merlin tumor suppressor functions.PMID:26549232
Merlin and Ezrin are components of a mechanism where mechanical forces associated with cell junctions are transduced across the cell cortex via cortical actomyosin cytoskeleton to control lateral mobility and activity of epidermal growth factor receptor.PMID:26483553
The study describe a novel NF2 mouse model recapitulating schwannoma phenotypes found in human patients where tumors develop in the cranial nerve VIII and/or the spinal roots.PMID:25113746
Nf2/Merlin controls spinal cord neural progenitor function in a Rac1/ErbB2-dependent manner.PMID:24817309
Nf2-Yap signaling plays important roles in controlling the expansion of dorsal root ganglia progenitors and glia during DRG developmentPMID:25433207
CD44 cytoplasmic tail cleaved by RIP could release DCAF1 from merlin by competing for binding to the merlin FERM domain, which results in the inhibition of merlin-mediated suppression of tumorigenesis.PMID:24912773
Findings indicate that merlin is sumoylated and that this post-translational modification is essential for tumor suppression.PMID:24166499
Cdc42 regulates SC radial sorting in vivo through Neurofibromin 2/merlin dependent signaling pathwaysPMID:24014231
The data establish a clear role for Nf2 upstream of Yap in the preimplantation embryo and demonstrate that Hippo signaling is essential to segregate the inner cell mass from the trophectoderm.PMID:23791728
These results indicate that in both Drosophila and mammals, Merlin activates Wts/Lats phosphorylation without stimulating the intrinsic kinase activity of Hpo/Mst.PMID:24012335
Meningioma progression in mice triggered by Nf2 and Cdkn2ab inactivation.PMID:23045274
Signaling between Nf2 and Rac1 occurs in a bidirectional fashion, and these interactions are modulated by PKA.PMID:23045281
Nf2 is required for hippocampal morphogenesis. Yap/Taz are key downstream effectors of Nf2 during brain development.PMID:23863479
Neurofibromin 2 is an AKAP (A-kinase-anchoring protein) scaffold protein that facilitates the function of the cAMP/PKA-LATS-YAP pathway.PMID:23644383
propose that Merlin mediates contact inhibition and suppresses tumorigenesis by translocating to the nucleus to inhibit CRL4(DCAF1).PMID:21878678
Results demonstrate that Schwannomin plays an essential role in inducing and/or maintaining the SC's spindle shape, and by stabilizing the bipolar morphology, Sch promotes the alignment of SCs with axons and ultimately influences myelin segment length.PMID:21182951
FERM domain-mediated phosphoinositide binding and membrane association are critical for the growth-regulatory function of merlinPMID:21402777
Depletion of Angiomotin in Nf2(-/-) Schwann cells attenuates the Ras-MAPK signaling pathway, impedes cellular proliferation in vitro and tumorigenesis in vivoPMID:21481793
Neurofibromatosis type 2 protein is inactivated in glioblastoma cells by overexpression of ezrin.PMID:20156804
Results reveal that Merlin can associate directly with alpha-catenin and link it to Par3, thereby providing an essential link between the AJ and the Par3 polarity complex during junctional maturation.PMID:21074722
a critical role for Nf2/Merlin in controlling homeostasis of the liver stem cell nichePMID:20675406
Nf2-deficient phenotypes in multiple tissues were largely suppressed by heterozygous deletion of Yap, suggesting that YAP is a major effector of Merlin/NF2 in growth regulation.PMID:20643348
This study provided merlin plays a pivotal role in controlling the neuronal wiring in the developing CNS.PMID:20668201
Tumor suppression by merlin is independent of its role as an organizer of the actin cytoskeleton in Schwann cells.PMID:19910496
Rac1-mediated canonical Wnt signaling is essential for the loss of contact inhibition in NF2-deficient cells.PMID:20154721
Structural basis for neurofibromatosis type 2PMID:11756419
phosphorylation of merlin at serine 518 leads to dramatic protein relocalizationPMID:11782491
Nf2 and p53 mutations do not synergize in meningeal tumorigenesis.Nf2 gene inactivation in arachnoidal cells is rate-limiting for meningioma development in the mouse.PMID:12000789
Mutant products of the NF2 tumor suppressor gene are degraded by the ubiquitin-proteasome pathwayPMID:12130630
A FERM domain mutant of the Nf2 tumor suppressor gene causes cellular transformation and tumorigenesis in micePMID:12203111
Merlin inhibits Pak1;loss of Merlin leads to inappropriate activation of Pak1. Conversely, the overexpression of Merlin leads to inhibition of Pak1 activation.PMID:14580336
biallelic loss of Nf2 function in neural crest-derived cells hemizygous for p53 results in resistance to osteogenic tumours and increased susceptibility to peripheral nerve sheath tumoursPMID:15221010
erbin regulates MAP kinase activation in Schwann cells and suggest that erbin links merlin to both adherens junction protein complexes and the MAP kinase signaling pathway.PMID:15659388
NF2 tumor suppressor Merlin and the ERM proteins interact with N-WASP and regulate its actin polymerization functionPMID:15699051
In brain tissue and neuronal progenitor cell cultures merlin was predominantly found in neurons. Merlin expression was seen from Day 11 in mouse embryos.PMID:15797715
These results suggest that merlin contributes, via its protein-to-protein interaction with Grb2 and consequent inhibition of the MAPK pathways.PMID:16405865
PP1-delta and MYPT-1 were co-precipitated with endogenous merlin from NIH-3T3 cellsPMID:16885985
inhibition of the CD44-HA interaction contributes to the tumor-suppressor function of merlin, and they suggest that merlin inhibits tumor growth, at least in part, by negatively regulating CD44 functionPMID:16953231