Home
Product
Protein
Active Protein
Other
Recombinant Mouse Macrophage colony-stimulating factor 1 receptor (Csf1r), partial (Active)

Recombinant Mouse Macrophage colony-stimulating factor 1 receptor (Csf1r), partial (Active)

In Stock

Code: CSB-MP006044MO

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$114

Quantity:

Express system: Mammalian cell

Species: Mus musculus (Mouse)

Tag Info: C-terminal hFc1-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Mouse Csf1r protein, partial (Active)

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1(CSB-MP006043MO) at 2 μg/mL can bind Mouse Csf1r. The EC50 is 3.226-4.264 ng/mL.

Target Names

Csf1r

Uniprot NO.

P09581

Alternative Names

Macrophage colony-stimulating factor 1 receptor; CSF-1 receptor (CSF-1-R; CSF-1R; M-CSF-R) (EC:2.7.10.1) . EC:2.7.10.1 ; Proto-oncogene c-Fms; CD115; Csf1r; Csfmr, Fms

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

20-511aa

Target Protein Sequence

APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

84.1 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Storage

Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1(CSB-MP006043MO) at 2 μg/ml can bind Mouse Csf1r. The EC₅₀ is 3.226-4.264 ng/mL.

Description

CSF-1R orchestrates macrophage differentiation and survival, making its extracellular domain a critical target for interrogating myeloid cell biology and therapeutic intervention in tumor-associated macrophage reprogramming. This construct spans residues 20–511, capturing the complete ligand-binding architecture, and demonstrates quantified binding to recombinant mouse CSF-1 with an EC50 of 3.2–4.3 ng/mL in functional ELISA, providing a validated reagent for competitive inhibition assays, blocking antibody screening, and therapeutic antibody epitope mapping. Mammalian expression ensures native glycosylation and disulfide patterning essential for physiological receptor conformation, supporting high-confidence data in surface plasmon resonance affinity characterization and biolayer interferometry kinetic studies. The protein meets purity and endotoxin criteria typical for ligand-receptor interaction platforms (>90% pure, <1.0 EU/μg), aligning with standards expected in small-molecule inhibitor screening and biologic drug discovery workflows targeting the CSF-1/CSF-1R axis.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding, including the ERK1/2 and the JNK pathway. Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor. In the central nervous system, may play a role in the development of microglia macrophages.

Gene References into Functions

CSF1R-dependent macrophages have roles in control of the intestinal stem-cell niche PMID:29593242
Targeting MAMs by CSF1R blocking mAbs may be promising methods to (re)sensitize myeloma cells to chemotherapy. PMID:28626216
Findings indicate that colony stimulating factor-1 receptor (CSF1R) signalling regulates inflammation in the central and peripheral nervous system in amyotrophic lateral sclerosis (ALS), suggesting therapeutic targeting of CSF1R in this disease. PMID:27174644
These findings reveal a novel and functionally important role for EHD1 in governing CSF-1R signalling via regulation of anterograde transport of CSF-1R to the macrophage cell surface. PMID:27224507
Our findings thus demonstrate that microenvironmental alteration by CSF-1R blockade renders tumor cells more susceptible to receptor tyrosine kinase inhibition in a preclinical glioblastoma model, which may have important translational relevance PMID:28759044
CSF-1R role in the development of erythro-myeloid progenitor cells in the developing fetal liver PMID:26235516
analysis of CSF1R-deficient mice establishes a distinct role of CSF1R in fetal B-lymphopoiesis. PMID:27207794
this study shows that the iRhom2/ADAM17 pathway plays an important role in regulating CSF1R expression in the myeloid cell compartment at steady state, and in modulating development of monocytes/macrophages during their repopulation PMID:27601030
this study shows that macrophage maturation is accompanied by colony-stimulating factor 1hypomethylation, and illustrates for the first time the ability of protein kinase A to increase Csf1r DNA methylation PMID:27353657
Targeting of macrophages by either CSF1R signaling blockade or clodronate liposome-mediated cell killing has marked inhibitory effects on established leukemia. PMID:26876171
these data indicate that CSF-1R signalling is critical for maintaining cardiac tissue resident M2-polarized macrophage population PMID:26407006
Macropinosomes might be a central mechanism coupling CSF-1R signaling and macrophage growth. PMID:25335894
Results indicate that prostaglandin E2 activates colony-stimulating factor-1 receptor (CSF-1R) and synergizes with its signaling at mitogen-activated protein kinase ERK1/2 level in promoting macrophage migration. PMID:25757564
These findings indicate that PU.1-mediated upregulation of CSF-1R is a critical effector of MLL leukemogenesis. PMID:25529853
All-lymphoid progenitors ALPs express higher levels of CSF1R transcripts than their upstream precursors, but only limited cell-surface CSF1R expression. ADAM17 knockouts have more CSF1R surface expression. PMID:25308957
an ongoing requirement for CSF1R signaling in macrophage and OCL homeostasis but indicate that most effects of CSF1 and CSF1R mutations are due to effects on development. PMID:24652541
This study show that the adult brain has a remarkable capacity to regulate and renew its microglia population, through microglial progenitor cells, and that the CSF1R plays a crucial role in microglial tissue homeostasis. PMID:24742461
CSF-1 receptor-mediated differentiation of a new type of monocytic cell with B cell-stimulating activity. PMID:24052571
The data argue that key signalling responses to CSF-1 depend on the ability of the CSF-1R to signal from endosomes following its internalisation, thus adding an important spatiotemporal aspect to CSF-1R signalling. PMID:22575736
results identify TAMs as a promising therapeutic target for proneural gliomas and establish the translational potential of CSF-1R inhibition for GBM PMID:24056773
CSF-1R directly supports Paneth cell (PC) maturation and that in turn PCs fashion the intestinal stem cell niche. PMID:23314290
The data indicate that CSF-1R signaling plays an important role in colon homeostasis and stem cell gene expression. PMID:23451116
Fms-Intronic Regulatory Element is an orientation-specific transcribed enhancer elemen PMID:23383005
CSF1/CSF1R signaling is important in the recruitment of tumor-infiltrating myeloid cells that can limit the efficacy of radiotherapy PMID:23418320
M-CSF binding to its receptor, c-Fms, results in increased c-Fms activation in Nf1(+/) (-) osteoclast progenitors, mediating multiple gain-in-functions through the downstream effectors Erk1/2 and p90RSK. PMID:23144792
Colony-stimulating factor 1 receptor signaling in injured neurons facilitates their protection and survival. PMID:23296467
CSF-1R signaling controls the development of the macrophage lineage at a relatively late stage under steady state conditions PMID:21727904
The expression of CSF-1R in neurons could be up-regulated by ischemic injury in the central nervous system. PMID:21141543
ablation of the Csf1r gene in Nestin-positive neural progenitors led to a smaller brain size, an expanded neural progenitor pool and elevated cellular apoptosis in cortical forebrain PMID:22542597
Macrophage proliferation is regulated through CSF-1 receptor tyrosines 544, 559, and 807 PMID:22375015
p110delta-dependent translocation of exogenous CSF-1 to the nucleus-associated CSF-1Rs, correlating with a prominent role of p110delta in activation of the Rab5 GTPase, a key regulator of endocytic trafficking PMID:22084313
a structural and mechanistic consensus for the assembly of mouse CSF-1:CSF-1R complexes PMID:22153499
CSF-1R is required for the development of microglia, for a fully functional olfactory system and the maintenance of normal brain structure. PMID:22046273
CSF1R-expressing macrophages are crucial for epithelial cell death and adipocyte repopulation during mammary gland involution. PMID:22129827
Our data provide genetic and biochemical evidence that CSF-1R, through Gab2, utilizes different effectors at different stages of MNP development to promote their expansion PMID:21930791
Data demonstrate that PAX5 regulates Csf1r in B cells by reducing the frequency of binding of the basal transcription machinery to the promoter. PMID:21549805
TNF-alpha (in the presence of M-CSF) is capable of inducing osteoclastogenesis from bone marrow macrophages, and osteoclastogenesis is significantly stimulated by force application through the activation of c-Fms-mediated signaling PMID:20803546
CSF1R signaling is required only for the maturation and replacement of resident-type monocytes and tissue macrophages, and is not required for monocyte production or inflammatory function. PMID:20682855
Lnk binds to c-Fms and can blunt M-CSF stimulation PMID:20571037
c-Fms plays a central role in the pathogenesis of rheumatoid arthritis by mediating the differentiation and priming of monocyte lineage cells PMID:20181277
RT-PCR analyses of Csf1r mRNA revealed that mouse OCL use another promoter within this region, distinct from that used in placental trophoblasts, to generate an alternative 5'UTR. PMID:20123678
Accumulation of c-Cbl and rapid termination of colony-stimulating factor 1 receptor signaling in interferon consensus sequence binding protein-deficient bone marrow-derived macrophages PMID:11964285
transcription factor complex formation and chromatin fine structure alterations at the locus during maturation of myeloid precursor cells PMID:12101129
These observations correlate CSF-1R expression with changes in the growth and development of the normal and neoplastic prostate PMID:12381783
Fms and alpha(v)beta(3) collaborate in the osteoclastogenic process via shared activation of the ERK/c-Fos signaling pathway. PMID:12618529
correlation between gp130-dependent ERK MAP kinase signaling and c-fms gene activation PMID:14749363
Transfection into HC11 mammary epithelial cells with CSF1R mutated to express phe at the tyr-721 autophosphorylation site (HC11-CSF1R-721) creates a phenotype that lacks metastastic competence but maintains local invasiveness. PMID:14767486
dramatic bone defects in Csf1r(-/-) mice are caused by a deficiency of the osteoclast-mediated regulation of osteoblasts and that the osteoclast plays an important role in regulating osteoblastic bone formation during development PMID:15312244
Data show that in developing B cells, c-fms chromatin is silenced in distinct steps. PMID:15483629
CSF-1 receptor and the VEGFR-1 plays a predominant role not only in osteoclastogenesis but also in the maintenance of bone marrow functions. PMID:16172397

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Note=The autophosphorylated receptor is ubiquitinated and internalized, leading to its degradation.

Protein Families

Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily

Tissue Specificity

Widely expressed.

Database Links

UNIGENE: Mm.22574

KEGG: mmu:12978

STRING: 10090.ENSMUSP00000025523

Promotions