Recombinant Mouse Interleukin-2 receptor subunit beta (Il2rb), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Il2rb
Uniprot NO.
Research Area
Others
Alternative Names
Il2rbInterleukin-2 receptor subunit beta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; High affinity IL-2 receptor subunit beta; p70-75; CD antigen CD122
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
24-240aa
Target Protein Sequence
ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Gene References into Functions
  1. The larger pool of IL-2Rbeta chains in CD8+ T cells is required to sustain IL-2 signaling and contributes to the quantitatively greater proliferative response to IL-2 relative to that of CD4+ mouse primary T cell cultures. PMID:29259099
  2. Diabetes was accelerated in male and female NOD mice in which IL-2Rbeta signaling was modestly and selectively reduced in T cells. PMID:29259102
  3. c-REL, but not IkappaBNS, controlled the generation of classical CD25(+)Foxp3(-) precursors via direct binding to the Cd25 locus; propose that CD4(+)GITR(+)CD122(+)CD25(-)Foxp3(-) cells represent a Treg pre-precursor population, whose transition into Treg precursors is mediated via c-REL PMID:28652399
  4. Renal lesions are indeed modulated by intrinsic glomerular cells through the gamma-C/IL-2-beta receptor response, to date classically described only in immune cells. PMID:28111009
  5. CBP physically associates with the IL-2 receptor beta-chain. CBP, found in the nucleus in resting CTLL-2 cells, relocates to the cytoplasm after IL-2 stimulation in an MEK/ERK pathway-dependent manner. Thus, IL-2-mediated acetylation plays an important role in the modulation of cytokine signaling and T cell fate. PMID:27799311
  6. IL-2Rbeta-dependent signaling and CD103 functionally cooperate to maintain tolerance in the gut mucosa. PMID:25527788
  7. Thymic development of CD4+Foxp3+ regulatory T cells (Tregs) is highly dysregulated in IL-2 receptor (2Rbeta)-deficient mice. PMID:23315074
  8. CDCD11c+B220+CD122+ cells play an important role in xenograft rejection. Their absence in NOG mice may be critical in supporting the successful engraftment of xenotransplants. PMID:23018460
  9. This study demonstrated that IL-12 signaling plays a complex role during the induction of tolerance as the presence of exogenous IL-12 and the lack of IL-12 signaling both prevent complete induction of tolerance. PMID:22522341
  10. Continuous activation of the CD122/STAT-5 signaling pathway characterize regulatory lineage differentiation in the murine thymus. PMID:21541329
  11. Knockout mice exhibited deficit in prepulse inhibition of acoustic startle reflex, significant reductions in acoustic startle reactivity, and modest differences in behavior in elevated plus-maze test. (IL-2/15 receptor-beta) PMID:11864627
  12. role of the interleukin-2 receptor beta chain region between the two Stat5 docking sites in induction of interleukin-2 receptor alpha expression by interleukin-2 PMID:12231477
  13. Depletion of IL-2 in vivo induces memory CD8+ T cell division by an IL-15-independent but by an IL-2/15 receptor beta-dependent mechanism, implying a novel process for antigen-independent homeostasis of memory CD8+ T cells in vivo. PMID:15528339
  14. This study for the first time delineates the molecular mechanisms underlying regulation of mouse IL-2Rbeta gene transcription by Ets family proteins, partially with Egr-1, and thereby further elucidates the molecular basis of lymphocyte activation. PMID:15752766
  15. The multivesicular regions were present in the cap structure of these granules, suggesting that the uNK cells of the Tg2Rbeta mice had cytotoxic activity. PMID:16127247
  16. these cells make up a specialized subset of central memory T cells with distinguishable phenotypic characteristics, most notably the higher expression of CD122 and CD127 PMID:16920913
  17. STAT5 binds to the promoter of the foxp3 gene suggesting that IL-2Rbeta-dependent STAT5 activation promotes Treg differentiation by regulating expression of foxp3. PMID:17182565
  18. a signal mediated by IL-2Rbeta is essential for the development and homeostasis of Foxp3(+) Treg in vivo PMID:17559173
  19. local blockade of the beta-chain of the IL-2R restored an immunosuppressive cytokine milieu in the lung that ameliorated both inflammation and airway hyperresponsiveness in experimental allergic asthma PMID:18641329
  20. Common gamma-chain binding-dependent activation of the shared IL-15/IL-2 receptor beta/common gamma signaling pathway may play an important role in the activation of natural killer (NK) cells and CD8-positive T cells, resulting in tumor growth inhibition. PMID:19050240
  21. IL-9Ralpha and IL-2Rbeta homodimers efficiently mediate constitutive activation of ALL-associated JAK1 mutants. PMID:19139102
  22. subset of IL-2-dependent targets is indexed to a low IL-2R signaling threshold PMID:19185518
  23. A population of memory CD8 T cells generated under sterile inflammatory conditions is identified by intermediate expression levels of CD122/CD44 and is involved in recall contact hypersensitivity reactions responsible for allergic contact dermatitis. PMID:19265164
  24. IL2R beta-chain induces growth potential for glandular epithelial cells and an immune-privileged condition mediated by CD25+regulatory-T cells. PMID:19293560

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell surface.
Protein Families
Type I cytokine receptor family, Type 4 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1