Abbreviation
Recombinant Mouse Il2ra protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Il2ra at 2 μg/mL can bind Mouse Il2 (CSB-MP011629MOd9). The EC50 is 95.00-116.2 ng/mL.
Alternative Names
Interleukin-2 receptor subunit alpha; IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA;p55; CD25; Il2ra; Il2r
Species
Mus musculus (Mouse)
Expression Region
22-236aa
Target Protein Sequence
ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Il2ra at 2 μg/ml can bind Mouse Il2 (CSB-MP011629MOd9). The EC50 is 95.00-116.2 ng/mL.
-
The purity of Il2ra was greater than 95% as determined by SEC-HPLC
Description
CD25, the high-affinity alpha subunit of the IL-2 receptor, plays a central role in T cell activation and is a validated target in cancer immunotherapy and autoimmune disease research. This mammalian-expressed construct spanning residues 22–236 captures the complete extracellular ligand-binding domain and demonstrates quantified binding to mouse IL-2 with an EC50 of 95.00–116.2 ng/mL in functional ELISA, providing a defined benchmark for ligand-receptor interaction studies and competitive inhibition assays. The mammalian expression system ensures native glycosylation and disulfide bond formation critical for conformational integrity in surface plasmon resonance, biolayer interferometry, and therapeutic antibody epitope mapping experiments. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for blocking antibody screening, small-molecule inhibitor discovery, and affinity characterization workflows targeting the IL-2/IL-2R axis in immuno-oncology research.