Recombinant Mouse Interleukin-18 (Il18)

Code: CSB-YP011608MO
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: Yeast
Species: Mus musculus (Mouse)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Il18
Uniprot NO.
Research Area
Immunology
Alternative Names
Il18; Igif; Interleukin-18; IL-18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
1-192aa
Target Protein Sequence
MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.1kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Recombinant Mouse Interleukin-18 (Il18) is produced in a yeast expression system, covering the full length of the protein from amino acids 1 to 192. This product features a C-terminal 6xHis-tag, which makes purification and detection more straightforward. The protein appears to be highly pure, with a purity level exceeding 90% as determined by SDS-PAGE. This product is intended for research use only and may provide reliable performance in experimental applications.

Interleukin-18 (IL-18) is a pro-inflammatory cytokine that's involved in regulating immune responses. It plays a key role in stimulating the production of interferon-gamma in T cells and natural killer cells. IL-18 seems significant in various immune pathways, contributing to the body's defense mechanisms against infections and helping regulate immune-mediated inflammatory processes. Studying this protein is likely crucial for understanding immune function and inflammatory diseases.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant mouse IL-18 is produced in a yeast expression system as a full-length protein (1-192aa) with a C-terminal 6xHis-tag. IL-18 is a pro-inflammatory cytokine that requires precise folding, disulfide bond formation, and proper tertiary structure for its biological activity in immune cell activation. Yeast expression systems provide eukaryotic folding machinery that can support disulfide bond formation and some post-translational modifications, increasing the probability of correct folding compared to prokaryotic systems. However, IL-18 is typically produced as an inactive precursor that requires cleavage by caspase-1 for full activity, and the C-terminal His-tag may interfere with receptor binding or protein function. No validation data (e.g., cell-based activity tests, receptor binding assays) are provided. Therefore, while yeast expression increases the likelihood of proper folding, the protein's bioactivity cannot be confirmed without experimental validation.

1. In Vitro Immunological Assays and Cytokine Response Studies

If properly folded and bioactive, this recombinant IL-18 could be used to stimulate immune cells and study cytokine responses. However, if inactive (likely without caspase-1 processing), it will not induce interferon-gamma production or immune activation, leading to false-negative results. The C-terminal His-tag may also interfere with receptor binding even if the protein is correctly folded.

2. Antibody Development and Validation

This application is suitable as antibody generation primarily relies on linear epitope recognition. The full-length protein provides comprehensive epitope coverage. However, if misfolded, antibodies may not optimally recognize conformational epitopes of native IL-18 in biological contexts.

3. Protein-Protein Interaction Studies

If correctly folded, the His-tagged IL-18 could be used to study interactions with IL-18 receptors or binding proteins. However, if misfolded, interaction domains may be altered, leading to non-specific binding or failure to identify genuine biological partners.

4. Biochemical Characterization and Structural Studies

If properly folded, the protein is suitable for biophysical characterization. However, if misfolded, structural data would misrepresent the native properties of IL-18. The C-terminal tag may interfere with some structural analyses.

Final Recommendation & Action Plan

Before using this recombinant IL-18 in functional studies, validate its bioactivity through cell-based assays (e.g., measuring interferon-gamma induction in appropriate cell lines) and confirm folding via biophysical methods (circular dichroism, size-exclusion chromatography). If validation confirms activity, proceed with applications, noting potential tag interference. If inactive, consider using caspase-1 to process the protein to its active form or obtain a commercially validated active IL-18 standard. For immediate use, antibody development can proceed with the understanding that antibodies may require validation against native protein. Always include appropriate controls (e.g., known active IL-18) in experiments to ensure reliability.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
A proinflammatory cytokine primarily involved in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells.
Gene References into Functions
  1. This study identifies a role for IL18 in suppressing aberrant neuronal transmission in AD. PMID:30127003
  2. Chimeric antigen receptor T cells releasing IL-18 convert to T-Bet(high) FoxO1(low) effectors that exhibit augmented activity against advanced solid tumors. PMID:29241547
  3. The data suggest that inflammasome signaling is largely protective during murine coronavirus infection, in large part due to the pro-inflammatory effects of IL-18. PMID:28895072
  4. downstream mediator of IL18 receptor activation, phospho-NF-kB, was increased in basolateral amygdala neurons expressing IL18 receptors PMID:27590137
  5. This study provides the first evidence of the ability of IL-18 to induce B-type natriuretic peptide synthesis in vitro and outlines the relationship between the two molecules in acute HF patients with an ongoing inflammatory status. PMID:24585936
  6. Interleukin-18 plays a role in advancing sepsis-induced cardiac dysfunction through inhibition of PP2A activity. PMID:28526544
  7. These observations suggest that IL-18 exerts direct effects upon the GnRH neuron via IL-18Ralpha and acts on GnRH neurons through an autocrine or paracrine pathway. PMID:28373090
  8. Reduced IL-18 serum concentration in children after HUS with no difference in its urine concentration may indicate a loss of the protective effects of this cytokine on renal function due to previously occurred HUS. PMID:27982687
  9. In conclusion, liver X receptor activation inhibits IL-18 production through regulation of its transcription and maturation into an active pro-inflammatory cytokine. PMID:27149934
  10. MyD88 signaling in myeloid and dendritic cells is dispensable for IFN-gamma-dependent control of type A F. tularensis infection. PMID:28951422
  11. study found that IL-18 and IL-1beta are differentially regulated. Despite being constitutively expressed, IL-18 expression was increased and sustained after stimulation of TLRs. In contrast, IL-1beta was induced but not sustained after chronic treatment. PMID:28468974
  12. This provides new insight into the immune phenotype, mechanisms, and signaling pathways that operate in microglial neurotoxic activation in amyotrophic lateral sclerosis. PMID:28336525
  13. the GLA-SE adjuvant operates through interaction with IL-18-producing SCMsmall ef, Cyrillic for the rapid induction of B cell expansion and differentiation, Ab secretion, and Th1 responses PMID:27794001
  14. IL-18 is essentially involved in mediating C. jejuni infection in the gnotobiotic mouse model. PMID:27322540
  15. These results demonstrate a central role for the AIM2 inflammasome in preventing dysbiosis and intestinal inflammation through regulation of the IL-18/IL-22BP/IL-22 and STAT3 pathway PMID:27524110
  16. Aldosterone induced IL-18 gene expression in renal tubular epithelial cells in a concentration- and time-dependent manner. PMID:27413021
  17. this study demonstrated the critical function of IL-18 in lipid metabolism and these findings might contribute to the progress of novel treatments for nonalcoholic fatty liver disease or nonalcoholic steatohepatitis. PMID:27063959
  18. Results indicated that IL-18 has roles apart from those as a proinflammatory cytokine in cardiac myocytes and suggested that IL-18 contributes to the homeostatic maintenance of mitochondrial function and gap-junction turnover in cardiac myocytes, possibly by upregulating autophagy. PMID:27288439
  19. IL-18-elicited NK cell perforin responses seem to be critical for coordinating mucosal inflammation during early infection PMID:27341123
  20. Data indicate that NLRC4 activation in Intestinal epithelial cells (IECs) leads to cell expulsion and IL-18 release, and implicate Caspase-8 in NLRC4 inflammasome responses in vivo by generation of doubly deficient in Caspase-1 and Caspase-8. PMID:28410991
  21. this study shows that IL-18, cooperatively with IL-23, induced prominent inflammation and enhanced psoriasis-like epidermal hyperplasia PMID:28299442
  22. telmisartan can reduce traumatic cerebral edema by inhibiting the NLRP3 inflammasome-regulated IL-1beta and IL-18 accumulation. PMID:27465336
  23. Data, including data from studies in knockout mice, suggest that TNF (tumor necrosis factor), TNFR1 (TNF receptor 1), and IL18 (interleukin 18) are involved in liver lipid metabolism. IL18 or TNFR1 knockout mice on chow show higher liver triglyceride deposition than wild-type mice fed chow; in IL18 or TNFR1 knockout mice, high-refined-carbohydrate diet does not lead to fatty liver disease as it does in wild-type mice. PMID:27863204
  24. GABA-B receptor antagonists reduced Il18 levels in male mice and increased Il18 levels in female mice following neonatal hypoxia ischemia. PMID:27731803
  25. NLRP1 is an innate immune sensor that functions in the context of metabolic stress to produce IL-18, preventing obesity and metabolic syndrome. PMID:26603191
  26. an important role in iNKT cell-mediated experimental eosinophilic esophagitis PMID:25801352
  27. IL-18 is sufficient to protect Birc3-deficient mice from sodium dodecyl sulfate-induced colitis. PMID:26037070
  28. IL-18 plays a facilitative role via NF-kappaB activation in pulmonary hypertension formation. PMID:26440469
  29. IL-18 is a key epithelial-derived cytokine that differentially regulates distinct subsets of intestinal CD4(+) T cells during both homeostatic and inflammatory conditions PMID:25736457
  30. Genetic ablation of IL-18 does not protect mice against maladaptive right ventricular remodeling following exposure to hypobaric hypoxia. PMID:26747780
  31. We conclude that in the systemic lupus erythematosus syndrom IL-18 is involved specifically in the renal pathogenesis PMID:26465326
  32. These results uncover the direct role of IL-18 in promoting goblet cell dysfunction during colitis, leading to breakdown of the mucosal barrier. PMID:26638073
  33. IL-18 is a potent stimulator of Chi3l1 and that Chi3l1 is an important mediator of IL-18-induced inflammatory, fibrotic, alveolar remodeling, and cytotoxic responses. PMID:25955511
  34. macrophages are not involved in IL-18-mediated susceptibility to L. amazonensis. PMID:26009021
  35. The published data prompt to the hypothesis that IL-18 induces a broad spectrum of COPD-like inflammatory and remodeling responses in the murine lung PMID:25922275
  36. Following hypoxic ischemic insult, long term creatine monohydrate supplementation up regulates the IL-6 and IL-18 concentrations triggering the neuroinflammatory and neuroprotective responses. PMID:26639507
  37. High and fluctuating levels of glucose may be associated with inflammation and diabetic atherosclerosis by regulating the expression levels of IL-18. PMID:25955000
  38. a new mechanism by which PKC-beta activation promotes EC dysfunction caused by the de-regulation of the IL-18/IL-18BP pathway, leading to increased VCAM-1 expression, monocyte/macrophage adhesion, and accelerated atherosclerotic plaque formation in diabetes PMID:25808972
  39. PMA treatment during a vulnerable period can alter brain development. IL-18 and IRAK-4 appear to be important for the development of PMA induced injury. PMID:25918710
  40. IL-18 levels modulate innate immune responses and cryptosporidiosis in mice. PMID:25155632
  41. these results indicate that the TLR2/NLRP3/CASP1/IL-18 axis is critical to H. pylori-specific immune regulation. PMID:26214524
  42. This study identifies NCC as an IL18-binding protein that collaborates with IL18r in cell signaling, inflammatory molecule expression, and experimental atherogenesis. PMID:26099046
  43. Neutralization of IL-18 during alveolar hypoxia improves left ventricle diastolic function and partly prevents right ventricle hypertrophy PMID:25182570
  44. This study reveals essential role of autophagy as a negative regulator of lung inflammation and identifies IL-18 as a critical mediator in lung injury due to autophagy deficiency. PMID:25888640
  45. IL-18, but not IL-1beta has a role in aberrant actin depolymerization that triggers the pyrin inflammasome and autoinflammatory disease PMID:26008898
  46. findings show how TLR2 deficiency accelerates IL18-mediated immunosuppression during liver carcinogenesis PMID:25600646
  47. Nlrp3 inflammasome is essential for resistance against P. brasiliensis because it orchestrates robust caspase-1 activation and triggers an IL-18-dependent proinflammatory response. PMID:25825440
  48. IL-18 can positively impact bone marrow lymphopoiesis and T cell development, presumably via interaction with the c-Kit and IL-7 signaling axis. PMID:25780034
  49. Alprostadil treatment can protect renal function by reducing proteinuria. These effects are mediated, at least in part, through down-regulation of Ang-2 and IL-18 expression PMID:25200363
  50. IL-18 was required for the expression of IL-22 in innate lymphoid cells upon Toxoplasma gondii infection. PMID:25680273

Show More

Hide All

Subcellular Location
Cytoplasm. Secreted.
Protein Families
IL-1 family
Database Links

UNIGENE: Mm.1410

KEGG: mmu:16173

STRING: 10090.ENSMUSP00000137193

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products