Recombinant Mouse Interferon regulatory factor 1 (Irf1)

Code: CSB-EP011814MO
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$256
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Irf1
Uniprot NO.
Research Area
Cardiovascular
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-329aa
Target Protein Sequence
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQRKERKSKSSRDTKSKTKRKLCGDVSPDTFSDGLSSSTLPDDHSSYTTQGYLGQDLDMERDITPALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPTHIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMKNMDSIMWMDSLLGNSVRLPPSIQAIPCAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.2 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. Regulates transcription of IFN and IFN-inducible genes, host response to viral and bacterial infections, regulation of many genes expressed during hematopoiesis, inflammation, immune responses and cell proliferation and differentiation, regulation of the cell cycle and induction of growth arrest and programmed cell death following DNA damage. Stimulates both innate and acquired immune responses through the activation of specific target genes and can act as a transcriptional activator and repressor regulating target genes by binding to an interferon-stimulated response element (ISRE) in their promoters. Binds to a consensus sequence in gene promoters. Its target genes for transcriptional activation activity are: genes involved in anti-viral response, such as IFN-alpha/beta, DDX58/RIG-I, TNFSF10/TRAIL, ZBP1, OAS1/2, PIAS1/GBP, EIF2AK2/PKR and RSAD2/viperin; antibacterial response, such as NOS2/INOS; anti-proliferative response, such as p53/TP53, LOX and CDKN1A; apoptosis, such as BBC3/PUMA, CASP1, CASP7 and CASP8; immune response, such as IL7, IL12A/B and IL15, PTGS2/COX2 and CYBB; DNA damage responses and DNA repair, such as POLQ/POLH; MHC class I expression, such as TAP1, PSMB9/LMP2, PSME1/PA28A, PSME2/PA28B and B2M and MHC class II expression, such as CIITA; metabolic enzymes, such as ACOD1/IRG1. Represses genes involved in anti-proliferative response, such as BIRC5/survivin, CCNB1, CCNE1, CDK1, CDK2 and CDK4 and in immune response, such as FOXP3, IL4, ANXA2 and TLR4. Stimulates p53/TP53-dependent transcription through enhanced recruitment of EP300 leading to increased acetylation of p53/TP53. Plays an important role in immune response directly affecting NK maturation and activity, macrophage production of IL12, Th1 development and maturation of CD8+ T-cells. Also implicated in the differentiation and maturation of dendritic cells and in the suppression of regulatory T (Treg) cells development. Acts as a tumor suppressor and plays a role not only in antagonism of tumor cell growth but also in stimulating an immune response against tumor cells.
Gene References into Functions
  1. IRF-1 regulates Rab27a transcription and extracellular vesicles secretion, leading to oxidized phospholipid activation of neutrophils and subsequent hepatic ischemia reperfusion injury. PMID:29059701
  2. Low IRF1 expression is associated with lymphoma. PMID:28975621
  3. Knockout of IRF-1 decreased expression and release of HMGB1 in liver, and inhibiting the release of HMGB1 could alleviate hepatic ischemia-reperfusion injury. PMID:30016764
  4. this study shows that IRF-1 is a regulator of lipopolysaccharide -induced endothelial proinflammatory activation PMID:28658674
  5. IRF-1 may be a critical factor in augmenting LPS-induced oxidative stress and mitochondrial damage in macrophages. PMID:28849179
  6. IRF-1 plays a key role in controlling caspase-1-dependent pyroptosis and inflammation. PMID:26939040
  7. Results indicate IRF-1 is one of the key transcriptional factors for the prevention of neointimal formation involving angiotensin II type 2 receptors. PMID:27597242
  8. Data show that HCFC2 is a critical component of the IRF1 and IRF2 transcriptional machinery that regulates Tlr3 gene expression. PMID:28970238
  9. Data show that the Japanese encephalitis virus (JEV)-induced expression of miR-301a led to inhibition of the production of the transcription factor IFN regulatory factor 1 (IRF1) and the signaling protein suppressor of cytokine signaling 5 (SOCS5). PMID:28196914
  10. Our studies uncovered the critical role of two transcription factors, IRF1 and BATF, in preparing the chromatin landscape for induction of the Tr1 gene network in response to IL-27 signaling, where BATF acted as a pioneer factor and prepared the genomic landscape for the binding of additional transcription factors that define the Tr1 lineage. PMID:28166218
  11. IRF-1 and interferon-alpha with interferon-beta cooperate to control acute gammaherpesvirus infection. PMID:27795415
  12. this study shows that binding motifs for the transcription factors STAT1 and IRF1 are associated with robust and IL-4-resistant responses to IFN-gamma in macrophages PMID:28288101
  13. 5AZ had a protective effect after MI by potentiation of IRF1 sumoylation and is suggested as a novel therapeutic intervention for cardiac repair. PMID:26510961
  14. direct the expression of a set of genes, the IRF8/IRF1 regulome, that play critical roles in host inflammatory and antimicrobial defenses in mouse models of neuroinflammation and of pulmonary tuberculosis, respectively PMID:27001747
  15. couples synthesis of miR-342-5p to the antiviral interferon response PMID:26938778
  16. The gammaherpesvirus-driven germinal center expansion was exaggerated and lost its transient nature in the absence of interferon-regulatory factor 1 (IRF-1), a transcription factor with antiviral and tumor suppressor functions. PMID:26719266
  17. IRF1 is required for IRF8-induced gene expression in microglia. PMID:26318672
  18. in addition to regulating the enterocyte metabolic switch, Blimp1 functions as a gatekeeper in opposition to Irf1 to prevent premature activation of the MHC class I pathway in villus epithelium to maintain tolerance in the neonatal intestine. PMID:26158850
  19. Although treatment with IFN-gamma strongly induced the activation of STAT1 as a transcriptional activator, its target molecule, IRF1, was not clearly produced in Lmp2-deficient uterine smooth muscle cells. PMID:26254356
  20. found that the effect of PGC-1alpha on repressing IRF-1 expression and activity is facilitated by the reduction in phosphorylation of STAT1 at position 727 (S727P), an essential transcriptional activator of IRF-1 PMID:25880742
  21. translocates into the nucleus and acts on the 3'UTR region of the IL-4 gene, thus inhibiting its transcription in Th2 cells during Listeria infection PMID:25280793
  22. these results underline the role of Batf2/Irf1 in inducing inflammatory responses in M. tuberculosis infection. PMID:25957166
  23. required for sensing of Francisella tularensis by AIM2 inflammasome PMID:25774715
  24. Protein Kinase C mu is required for TLR7/9-induced IRF-1 activation and IFN-beta upregulation in dendritic cells and acts downstream of BTK. PMID:25170774
  25. K63-linked polyubiquitination mediates alternative IL-1-induced signaling pathway PMID:24793404
  26. IRF-1 was essential for NO production by co-cultures and macrophage tumoricidal activity in vitro as well as for the control of tumor growth in vivo. PMID:25659093
  27. IRF-1 physically interacts with REDD2 in the large cytoplasmic protein complex PMID:24412152
  28. IRF-1 is essential to counteract the neuropathology of vesicular stomatitis virus PMID:24675692
  29. these findings identify IRF1 as a target for controlling the function of TH9 subset of helper T cells. PMID:24973819
  30. Interferon regulatory factor 1 restricts murine herpesvirus 68 replication in Macrophage. PMID:24719409
  31. IFN-alpha derived from liver plasmacytoid dendritic cells plays a key role in the pathogenesis of liver ischemia reperfusion injury by enhancing apoptosis as a consequence of induction of hepatocyte IRF-1 expression. PMID:24493010
  32. These data suggest the IRF1-iNOS axis as a crucial regulator of cardiac remodeling and that IRF1 could be a potent therapeutic target for cardiac remodeling. PMID:24732887
  33. Data suggest that antagonism of IRF-1 synergizes with the ability of flaviviruses to suppress IFN-alpha/beta receptor-dependent signaling. PMID:24532583
  34. we found that IRF1 was essential for IL-1-induced expression of the chemokines CXCL10 and CCL5 PMID:24464131
  35. Sirt1 antagonizes acetylation of IRF1, a transcription factor that drives IL-27 production. PMID:24214980
  36. Overexpression of IRF1 in kidney ischemia results in the production of interferon (IFN)alphas. PMID:23657854
  37. In a chronic model of proliferative nephritis, IRF1 and renal-expressed TNFR2 were essential for sustained macrophage accumulation. PMID:23623383
  38. Data indicate that PKCdelta regulates the expression of IRF1 and IRF1 was found to mediate the effects of PKCdelta on iNOS expression. PMID:23326354
  39. IRF-1 plays an essential cell-autonomous role in IFN-gamma-mediated inhibition of norovirus replication in macrophages. PMID:22973039
  40. Lactobacillus acidophilus induces IFN-beta signals independently of interferon regulatory factor (IRF)3 and IRF7 but is reduced in IRF3/7- and IRF1-deficient dendritic cells. PMID:22896628
  41. a novel role for IRF-1 in regulating both apoptosis and autophagy in splenocytes in the setting of endotoxemia with IRF-1 promoting apoptosis and inhibiting autophagy. PMID:22266972
  42. STAT1/IRF1 is a key growth inhibitory and tumor suppressive signaling pathway that prevents mammary cancer formation by maintaining growth control. PMID:22185785
  43. K1L and C7L antagonize IRF1-induced antiviral activities and that the host modulation function of C7L is evolutionally conserved in all poxviruses that can readily replicate in tissue-cultured mammalian cells. PMID:22345458
  44. we identified IRF-1 as an essential regulator of the host immune response against West Nile virus infection, and show that it governs processes of both the innate and adaptive immune responses that control outcome PMID:21909274
  45. These findings establish IRF-1 as an essential mediator of the cross-talk between tumor cells and natural killer cells that mediate immune surveillance in metastasis. PMID:21900395
  46. IFN-gamma induces expression of IRF-1 in murine erythroid precursors. PMID:21725055
  47. Data found that serum HMGB1 is acetylated after liver I/R and that this process was dependent on IRF-1. PMID:20856174
  48. Data show that RNA interference abolished IFN-gamma-induced TRIM22 expression, indicating an IRF-1-dependent expression of TRIM22. PMID:20631312
  49. Data show that alpha-GalCer-induced liver injury was significantly suppressed in IRF-1 knockout mice or in wild-type C56BL/6 mice that received a microRNA specifically targeting IRF-1. PMID:20624945
  50. IL-27 p28 gene transcription is activated by interferon regulatory factor 8 in cooperation with interferon regulatory factor 1 PMID:20435892

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
IRF family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products