Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Igf2; Igf-2Insulin-like growth factor II; IGF-II; Multiplication-stimulating polypeptide) [Cleaved into: Insulin-like growth factor II; Preptin]
Species
Mus musculus(Mouse)
Expression Region
25-91aa
Target Protein Sequence
AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Power up your signal transduction research with our Recombinant Mouse Igf2, also known as Insulin-like growth factor II. This protein, expressed in E.coli, is a crucial component in studies of growth regulation, cell survival, and cellular communication.
Our Igf2 is the full length of the mature protein (25-91aa), offering a complete representation of its structure and function. The protein is expressed with a N-terminal 6xHis-tag, ensuring efficient purification and optimal stability. With a purity exceeding 85% as determined by SDS-PAGE, our Recombinant Mouse Igf2 meets the highest standards for precision in scientific research. Choose between a liquid form for immediate experimentation or a lyophilized powder for extended stability, tailoring your research to new heights.