Recombinant Mouse Indian hedgehog protein (Ihh), partial

Code: CSB-YP011569MO
Size:
20ug
20ug100ug1mg
US$276
Quantity:
Express system: Yeast
Species: Mus musculus (Mouse)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Ihh protein, partial
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Ihh
Uniprot NO.
Research Area
Stem Cells
Alternative Names
HHG-2
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
28-202aa
Target Protein Sequence
CGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Intercellular signal essential for a variety of patterning events during development. Binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. Implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones. Induces the expression of parathyroid hormone-related protein (PTHRP).
Gene References into Functions
  1. Noggin null mutants show increased Indian hedgehog (Ihh) expression within cartilage condensations that leads to aberrant extension of IHH downstream signaling into the interdigital mesenchyme. A converse phenotype with increased apoptosis and reduced cell proliferation was found in the interdigital mesenchyme of Ihh mutant embryos, suggesting IHH's unrecognized physiological role for IHH in interdigital webbing biology. PMID:29771958
  2. This work reveals the molecular function of Hedgehog signaling in extrinsic sheath tissues for tendon repair. PMID:29244023
  3. melatonin not only elevated progesterone (P) secretion, but also upregulated expressions of StAR and Cyp11a1 and also had an increased Ihh expression in endometrium. PMID:28749439
  4. loss of Spop, but not Spopl, disrupts chondrocyte hypertrophy and osteoblast differentiation in the mouse, suggesting the requirement for Spop-mediated protein degradation in mouse skeletal development; overexpressed Spop targets both Gli3FL and Gli3R for ubiquitination and degradation and Spop is an important positive regulator of Ihh signaling and skeletal development PMID:27930311
  5. Ihh is regulated by at least 9 enhancers with individual tissue specificities in the digit anlagen, growth plates, skull sutures and fingertips. Consecutive deletions, resulting in growth defects of the skull and long bones, showed that these enhancers function in an additive manner. Duplications caused dose-dependent upregulation and misexpression of Ihh, abnormal phalanges, fusion of sutures and syndactyly. PMID:28846100
  6. GPC6 stimulates Hh signaling by binding to Hh and Ptc1 at the cilium and increasing the interaction of the receptor and ligand to promote the growth of developing long bones. PMID:28696225
  7. An accelerated hypertrophic differentiation caused by a disturbed Ihh-PTHrP signaling pathway may lead to a higher bone mineral density in the vertebral bodies of newborn Col IX -/- mice and, as a result, to the early onset of disc degeneration. PMID:27666725
  8. findings thus demonstrate that augmented Ihh signaling is detrimental to craniofacial development, and that finely tuned Ihh signaling is critical for temporomandibular joint formation. PMID:26553654
  9. Ihh has an important role in regulating limb mesenchymal cell differentiation PMID:26094741
  10. Ihh and PTH1R signaling in limb mesenchyme are both essential to regulate proper development of digit structures, although they appear to use different mechanisms. PMID:26620087
  11. The Annexin a2 Promotes Development in Arthritis through Neovascularization by Amplification Hedgehog Pathway. PMID:26963384
  12. Ihh expression was downregulated in femur epiphyses of Hand1-overexpressing mice. Hand1 downregulated Ihh gene expression in vitro by inhibiting Runx2 transactivation of the Ihh proximal promoter. PMID:26918743
  13. In organogenesis of the ovary, production of Dhh/Ihh in granulosa cells requires growth differentiation factor 9 from the oocyte. PMID:25917826
  14. increased expression in cell bodies of cutaneous sensory nerves of dorsal root ganglia as compared with skin epithelia PMID:25842978
  15. C/EBPbeta and RUNX2 cooperatively stimulate expression of Ihh through direct interactions with a C/EBPbeta binding element, which further promotes hypertrophic differentiation of chondrocytes during the chondrocyte differentiation process. PMID:25105964
  16. findings support the protective role of Ihh deletion in surgically induced osteoarthritis PMID:24428864
  17. Thyroid hormone regulates the secondary ossification center initiation and progression via differentiating chondrocytes into bone matrix-producing osteoblasts by stimulating Ihh and Osx expression in chondrocytes. PMID:24753031
  18. Apc mutant epithelial cells secrete IHH to maintain an intestinal stromal phenotype that is required for adenoma development in mice. PMID:25307863
  19. Cbfbeta functions in upregulating Ihh expression to promoter chondrocyte proliferation and osteoblast differentiation, and inhibiting PPR expression to enhance chondrocyte differentiation. PMID:24821091
  20. Indian Hedgehog, a critical modulator in osteoarthritis, could be a potential therapeutic target for attenuating cartilage degeneration disease. PMID:24844414
  21. Data indicate Indian hedgehog (Ihh) induces collagen type X COL10A1 expression and promotes its transcription through Runx2/Smad1 interactions on a specific promoter region. PMID:25028519
  22. Increased Ihh is associated with the severity of osteoarthritis cartilage damage. PMID:24786088
  23. Ihh signaling mediates gastrin-induced proliferation of epithelial cells in stomachs of adult mice. PMID:24859162
  24. Sirt6 regulates postnatal growth plate differentiation and proliferation via Ihh signaling. PMID:24149372
  25. Data indicate that the centrosomal protein DZIP1 interacts with GLI3 transcription factor in the cytoplasm and regulates Hedgehog signaling and ciliogenesis. PMID:23955340
  26. Data suggest that GPC3 down-regulates hepatocyte proliferation by binding to hedgehog (HH) and down-regulating the HH signaling pathway and binding with CD81, thus making it unavailable to bind to Hhex and causing its nuclear translocation. PMID:23665349
  27. Ihh signaling plays an important role in chondrocyte proliferation and differentiation via interactions with Runx2 and Runx3. PMID:23383321
  28. GABA(B)R1 positively regulates chondrogenesis through a mechanism relevant to the acceleration of nuclear translocation of ATF4 for Ihh expression in chondrocytes PMID:22879594
  29. The data indicated that Atf4 in chondrocytes is required for normal Ihh expression and for its paracrine effect on osteoblast differentiation. PMID:22190639
  30. Indian hedgehog requires additional effectors besides Runx2 to induce osteoblast differentiation. PMID:22155527
  31. study defines Ihh as an important positive regulator of cranial bone ossification PMID:21557453
  32. IGF-1R in chondrocytes controls cell growth, survival, and differentiation in embryonic and postnatal growth plates in part by suppression of Pthrp expression. PMID:21312270
  33. Loss of muscle mass in Ihh null mouse embryos is accompanied by a dramatic increase in myoblast apoptosis by a loss of p21 protein PMID:21683695
  34. Ihh signaling is essential for symphyseal cartilage development and anterior mandibular growth PMID:21297010
  35. The hedgehog pathway is activated during palatal fusion, and deletion of Indian hedgehog leads to diminished ossification of the secondary hard palate. PMID:21364421
  36. Loss of Ihh initiates several events that are characteristic of an intestinal wound repair response. Prolonged loss resulted in progressive inflammation, mucosal damage, and the development of intestinal fibrosis. PMID:20682322
  37. Ihh regulates intestinal stem cell self-renewal and differentiation. Intestinal epithelial Ihh signals to mesenchymal cells to regulate formation and proliferation of mesenchymal cells, which in turn affect epithelial proliferation and differentiation. PMID:20542037
  38. Indian hedgehog and WNT/beta-catenin signaling, inhibited by receptor tyrosine kinase-like orphan receptor 2 (ROR2) in distal limb mesenchyme, are acting upstream of BMP signaling in the phalanx-forming region PMID:20660756
  39. Ihh regulates embryo implantation by having an impact on the cell cycle, EGF signaling, and E2 signaling. PMID:20056671
  40. Hh proteins act as paracrine mitogens to promote the expansion of adjacent mesenchymal progenitors, including those of the smooth muscle compartment. PMID:20430747
  41. Ihh has both PTHrP-dependent and -independent functions during postnatal endochondral bone development. PMID:19761883
  42. Sostdc1, Penk1 and Igfbp5 were identified as possible new IHH signaling targets that may contribute to the molecular mechanism for BDA1. PMID:20024692
  43. continuous Ihh action is required for completion of post-natal temporomandibular joint growth and organization PMID:20200412
  44. Hedgehog signaling may be important stimulus for renal cyst formation. PMID:20007344
  45. Atf4 as a novel transcriptional activator of Indian hedgehog in chondrocytes that paces longitudinal bone growth PMID:19906842
  46. Gli2 and Gli3 collectively mediate all major aspects of Ihh function during endochondral skeletal development PMID:19906844
  47. Indian hedgehog as a progesterone-responsive factor mediating epithelial-mesenchymal interactions in the mouse uterus. PMID:11977981
  48. Data suggest that Grg5 modulates the activities of transcription factors in vivo to affect Ihh expression and the function of long bone growth plates. PMID:11984876
  49. Indian hedgehog control differentiation of growth plate chondrocytes at multiple steps. PMID:12050144
  50. neither Shh nor Ihh is required for mammary gland morphogenesis and functional differentiation PMID:12217324

Show More

Hide All

Subcellular Location
[Indian hedgehog protein N-product]: Cell membrane; Lipid-anchor; Extracellular side.; [Indian hedgehog protein C-product]: Secreted, extracellular space.; Cell membrane.
Protein Families
Hedgehog family
Tissue Specificity
In the embryo, detected in the developing gut, the growth zone of cartilage of developing long bones, epithelium and urogenital sinus. In the adult kidney, found in proximal convoluted and proximal straight tubule.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products