Recombinant Mouse Fibroblast growth factor 2 (Fgf2) (Active)

In Stock
Code: CSB-EP008625MO
Size:
20ug
20ug100ug1mg
US$306
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Fgf2
Uniprot NO.
Alternative Names
Fgf2; Fgf-2Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
10-154aa
Target Protein Sequence
PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

This recombinant mouse Fibroblast growth factor 2 (Fgf2) comes from E. coli and spans the complete mature protein sequence from amino acids 10 to 154. The protein carries an N-terminal 6xHis tag, which helps with purification and detection. SDS-PAGE analysis confirms it reaches over 90% purity, making it appropriate for research applications. This product is designed strictly for research purposes and appears to deliver consistent quality.

Fibroblast growth factor 2 (Fgf2) belongs to the fibroblast growth factor family and plays important roles in cellular growth, differentiation, and angiogenesis. It participates in several critical biological pathways, particularly wound healing and tissue repair. The significance of Fgf2 in developmental biology and regenerative medicine research may make it a useful tool for investigating cellular processes and exploring potential therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Mouse FGF-2 is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing properly folded eukaryotic growth factors like FGF-2. FGF-2 requires precise folding with three disulfide bonds for its receptor binding and bioactivity. While E. coli can express the protein, it often fails to form correct disulfide bonds without specialized strains or folding conditions. The protein contains the full-length mature sequence (10-154aa) with an N-terminal 6xHis tag, but the tag may interfere with the receptor-binding domain. Since activity is explicitly unverified and E. coli typically produces inactive FGF-2 without proper refolding, the protein is highly likely to be misfolded and inactive without experimental validation.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The N-terminal 6xHis-tag technically enables pull-down experiments, but if FGF-2 is misfolded (as expected in E. coli), it will not interact physiologically with FGF receptors or heparin sulfate proteoglycans. Identified interactions may be non-specific artifacts. This application should not be pursued without prior validation of proper folding and receptor binding activity. If used without validation, results will likely be misleading.

2. Antibody Development and Validation

This application is appropriate. The recombinant FGF-2 can serve as an immunogen for generating antibodies that recognize linear epitopes, even if misfolded. The >90% purity supports immunization protocols. However, antibodies may not recognize conformational epitopes of native, properly folded FGF-2. Validation against bioactive FGF-2 from mammalian expression systems is essential for physiological relevance.

3. Biochemical Characterization and Biophysical Analysis

This application is valuable for assessing the protein's state. Techniques like circular dichroism can reveal if secondary structure is present, while dynamic light scattering may detect aggregation. However, without activity validation, these studies characterize the recombinant product but cannot confirm native folding. It should be noted that these are quality control measures, not functional validation.

4. Comparative Species Analysis and Evolutionary Studies

This application is problematic without activity confirmation. If the mouse FGF-2 is misfolded, cross-species binding comparisons will yield invalid evolutionary insights. Structural comparisons require properly folded proteins from all species being compared. This application should be deferred until proper folding and bioactivity are demonstrated.

Final Recommendation & Action Plan

Given the high probability of misfolding in E. coli for this disulfide bond-dependent growth factor, the protein should first be characterized for structural integrity (circular dichroism, mass spectrometry for disulfide bonds) and functionally validated using a cell-based proliferation assay or receptor binding assay. If inactive, it may be useful only for antibody production or as a negative control; if active, it can be used for interaction studies. For reliable FGF-2 research, consider obtaining the protein from a mammalian expression system with verified activity. Always include proper controls (e.g., commercial bioactive FGF-2) in experiments.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.
Gene References into Functions
  1. expressed in tissues of the female reproductive tract; affects sperm motility and acrosomal exocytosis PMID:29866768
  2. present study highlights the central role for FGF-2 in the progression and maintenance of newly acquired blood and lymphatic vessels in the cornea of HSV-1-infected mice in the absence of infectious virions PMID:28378806
  3. NF-kappaBmiR15abFGF/VEGFA axis contributes to the impaired angiogenic capacity of bone marrowmesenchymal stem cells in high fat dietfed mice. PMID:28944834
  4. Knockout of the 18-kDa FGF-2 isoform significantly attenuated atherogenesis, reduced aortic plaques, reduced macrophage infiltration and suppressed oxidative stress in mice fed with a high fat diet at all-time points. PMID:29466783
  5. Data show that exostosin-like 2 (EXTL2) controls fibroblast growth factor 2 (FGF2) signaling through regulation of heparan sulfate biosynthesis. PMID:29305908
  6. FGF2 signaling can regulate osteoblastic niche cells to support HSC homeostasis in response to bone marrow damage PMID:28662672
  7. Dynamic changes in heparan sulfate during muscle differentiation and ageing regulate myoblast cell fate and FGF2 signaling. PMID:27496348
  8. altered glycosaminoglycans (GAG) distribution in mucopolysaccharidoses I (MPS I) chondrocytes, and altered GAG, FGF2 and Indian hedgehog distribution in growth plates from MPS I mice, is reported. PMID:27105565
  9. Data show that LOX-PP enhances adipogenesis at least partially through inhibition of FGF-2 receptor signaling. PMID:28452589
  10. tissue engineered periosteum can deliver FGF-2, TGF-beta1, and ASCs to a mouse critical-sized femur defect and further optimization may yield improved bone allograft healing. PMID:27874253
  11. Thus, FGF-2 levels in hESCs culture systems can be manipulated to generate cells with longer telomere which would be advantageous in the applications of hESCs in regenerative medicine. PMID:27757766
  12. Low FGF2 expression is associated with cardiac ischemia and systolic dysfunction. PMID:28771625
  13. Mechanical strain stimulates vasculogenesis of embryonic stem cells by the intracellular messengers ROS, NO and calcium as well as by upregulation of angiogenesis guidance molecules and the angiogenic growth factors VEGF, FGF-2 and PDGF-BB. PMID:27725190
  14. data suggest that FGF2 levels are critically related to anxiety behavior and hypothalamic pituitary- adrenal axis activity, likely through modulation of hippocampal glucocorticoid receptor expression, an effect that is likely receptor mediated, albeit not by FGFR1, FGFR2, and FGFR3. PMID:27133954
  15. The differentiation of ERF-overexpressing trophoblast stem cell lines also suggests that ERF may have an FGF2-independent effect during the commitment towards syncytiotrophoblasts. PMID:28244611
  16. Novel VF-Trap fusion protein on blockage of VEGF and FGF-2 activity to prevent angiogenesis. PMID:27130666
  17. FGF2 is an extracellular inducer of COUP-TFII expression and may suppress the osteogenic potential of mesenchymal cells by inducing COUP-TFII expression prior to the onset of osteogenic differentiation PMID:27404388
  18. These results support that controlling the aberrant expression of TGF-beta1 and FGF-2 via inhibition of Wnt/beta-catenin signaling could serve as a potential therapeutic strategy for pulmonary fibrosis. PMID:27112840
  19. (125)I-bFGF mAb inhibits growth of experimental hepatocellular carcinomas. PMID:27275095
  20. In vivo, GSPP treatment (200 mg/kg/d) not only inhibited the growth of colon carcinoma, but also inhibited the tumor lymphangiogenesis. Conclusion. GSPP possesses the antitumor ability by inhibiting bFGF-inducing lymphangiogenesis in vitro and in vivo, which may further inhibit tumor lymphatic metastasis. PMID:27190997
  21. The present study indicates that a broad array of genes associated with functions of the cytoskeleton is significantly dysregulated in the MSC cortex of FGF-2 knockout mice PMID:26970009
  22. Lack of fibroblast growth factor-2 results in an increased volume of the striatal target area in mice. PMID:26642808
  23. Low RICTOR expression was detected in quiescent, confluent mouse aortic endothelial cells, whereas high doses of FGF2 induced high RICTOR expression that was associated with strong mTORC2-specific protein kinase Ca and AKT phosphorylation PMID:26635098
  24. Endogenous FGF2 secreted by trophoectoderm cells regulates protein expression and distribution in trophectoderm cells via FGFR2. PMID:26378412
  25. IL-1beta promotes FGF-2 expression in chondrocytes PMID:26811540
  26. FGF2 monoclonal antibody inhibited angiogenesis B16-F10 metastatic melanoma model. PMID:26655277
  27. Both cell proliferation and hair inductive activity in murine DPCs are maintained by the synergistic effect of fibroblast growth factor 2 and platelet-derived growth factor receptor alpha. PMID:25975959
  28. These results demonstrated that recombinant human endostatin could in-hibit tumor metastasis by inhibition of the expression of c-Myc and bFGF in gastric cancer tissue as well as by inhibition of angiogenesis PMID:26125720
  29. Cytosolic LMW FGF2 functions as a negative regulator in RIG-I-mediated antiviral signaling. PMID:26466960
  30. Data show that, depending of its concentration, FGF2 can be either a positive or negative factor of adipogenesis by regulating the ERK signaling pathway providing a mechanistic basis for FGF2 roles in adipogenesis and development of fat tissues. PMID:25790378
  31. Trans-regulation of oligodendrocyte myelination by neurons through Arf6-regulated secretion of fibroblast growth factor-2. PMID:25144208
  32. Data indicate that microbiota-driven fibroblast growth factor 2 (FGF2) and interleukin-17 (IL-17) cooperate to repair the damaged intestinal epithelium. PMID:26320657
  33. suggest that CD44-positive cells might be a source of cerebellar oligodendrocytes and that FGF-2 plays important roles in their development at an early postnatal stage PMID:26079890
  34. This study reveals a novel role for the ERK5-MEF2 cascade, linking bFGF-induced PAI-1 expression and subsequent mitogenic processes in lung fibroblasts. PMID:26032256
  35. Astrocyte-derived bFGF is required for regulation of dopaminergic neurons differentiation of the stem cells and may provide a strategy targeting astrocytes for treatment of Parkinson's disease. PMID:25517983
  36. both bone morphogenetic protein and Wnt pathways may be involved in mediating the effects of fibroblast growth factor 2 on dental pulp cells PMID:25158181
  37. FGF2 isoforms modulate bone and phosphate homeostasis via multiple pathways related to bone formation, osteoblast differentiation, and Wnt and Fgf2 signaling. PMID:25389287
  38. Endostar might exert its anti-tumor effect via suppressing b-FGF-induced angiogenesis and b-FGF-activated MAPK signaling pathway. PMID:25597785
  39. Basic FGF stimulated mesenchymal stem cell proliferation is NF-kappaB pathway dependent. PMID:25065316
  40. FGF2 acts as a protective growth factor after lung epithelial injury, and call into question the role of FGF2 as a profibrotic growth factor in vivo. PMID:24988442
  41. The augmentation of FGF2 expression and reduced optokinetic responses during the resolution of surface vasculopathy may indicate a role for FGF2 in the maintenance of neuroretinal function in OIR/ROP. PMID:25525167
  42. These studies demonstrate a feedback loop between Klotho depletion and FGF2 activation in renal fibrosis. PMID:25130652
  43. These findings indicate that the lens epithelium of MCT mice has increased expression of TGFbeta before cataract affection and that changes in the expression of FGF2 as well as TGFbeta may contribute to the progression of the cataract in the mice. PMID:24279395
  44. FGF2 regulates lymphatic endothelial cell -specific gene expression and suppresses TGFB1 signalling through Smad2. PMID:24357720
  45. Topical secretoneurin gene therapy accelerates diabetic wound healing by interaction between heparan-sulfate proteoglycans and basic FGF. PMID:23918206
  46. 131 FGF2-regulated miRNAs during lens fiber cell differentiation PMID:24142921
  47. In this model the S-domains at the non-reducing ends of the two HS proteoglycan chains are proposed to interact with the FGF2-FGFR2 protein complex. PMID:24563485
  48. Data suggest that Fgf2-Fgfr2 (fibroblast growth factor 2/fibroblast growth factor receptor 2) signal cascade is involved in stimulating cell proliferation in prostate basal epithelium in absence of androgen replacement therapy following castration. PMID:23946540
  49. Therefore, constitutive deletion of Fgf2 or Fgfr1 knockdown in oligodendrocyte lineage cells is sufficient to overcome impairment of sensorimotor coordination after cuprizone demyelination. PMID:23684572
  50. expression of Mll-Ell in myeloid progenitor cells resulted in autocrine production of Fgf2 and Fgf2-dependent cytokine hypersensitivity. PMID:24089521

Show More

Hide All

Subcellular Location
Secreted. Nucleus.
Protein Families
Heparin-binding growth factors family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products