Home
Product
Protein
Recombinant Proteins
Recombinant Mouse Fibroblast growth factor 5 (Fgf5)

Recombinant Mouse Fibroblast growth factor 5 (Fgf5)

Baculovirus
Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

Fgf5

Uniprot NO.

P15656

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

21-264

Target Protein Sequence

HGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSPVAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVKPKVPLSQPRRSPSPVKYRLKFRFG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase.

Gene References into Functions

Recruited CD11b+ CD68+ Kupffer cells/Mphis may play an essential role in steatohepatitis and fibrosis in FGF5 null mice fed with a HFD. Recruitment and activation of bone marrow derived Mphis is the key factor to develop steatohepatitis from simple steatosis. PMID:27708340
It participates in the progression of hepatic fibrosis. PMID:24521867
Interaction of mutant genes Fgf5(go-Y), we, and wal changes the duration of hair growth cycles in mice PMID:22567929
A deletion of a 9.3-kb region in the Fgf5 gene showed insertion of a 498-bp early transposon element long terminal repeat. Results show that long hair mutation of moja/moja mice is caused by Fgf5 disruption mediated by retrotransposon insertion. PMID:21512271
parathyroid hormone-related protein and fibroblast growth factor-5 regulate the anagen to catagen transition by independent pathways PMID:12713572
the Fgf5(go) gene is a powerful modifier of mutant genes determining the process of alopecia. PMID:19534432