Recombinant Mouse Fibroblast growth factor 21 (Fgf21)

Code: CSB-EP008627MOc7
Size:
20ug
20ug100ug1mg
US$306
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Fgf21 protein
Purity
Greater than 95% as determined by SDS-PAGE.
Target Names
Fgf21
Uniprot NO.
Research Area
Others
Alternative Names
FGF-21
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
29-210aa
Target Protein Sequence
AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB. Regulates systemic glucose homeostasis and insulin sensitivity.
Gene References into Functions
  1. FGF21 alleviated atherosclerosis by ameliorating Fas-mediated apoptosis in apoE-/- mice. PMID:30157856
  2. results demonstrate that fibroblast growth factor 21 reduces the increased expression of a subset of genes in the liver in response to endoplasmic reticulum stress PMID:29962431
  3. Lack of FGF21 enhances the susceptibility to the development of obesity-related cardiomyopathy. PMID:29519677
  4. The acute increase in circulating FGF21 following fructose gavage was absent in ChREBP knockout mice. Induction of ChREBP-beta and its glycolytic, fructolytic, and lipogenic gene targets were attenuated in FGF21 knockout mice fed high-fructose diets. PMID:28123933
  5. Data, including data from studies using knockout mice, suggest that control of whole-body energy expenditure by Gcgr agonism requires intact Fxr signaling and Fgf21 secretion in liver. (Gcgr = glucagon receptor glucagon; Fxr = farnesoid X receptor; Fgf21 = fibroblast growth factor-21) PMID:29925501
  6. FGF-21 has anti-inflammatory effects in Type 2 diabetes mellitus PMID:29414665
  7. These data suggest that Fgf21 acts as one of intrathymic cytokines in the neonatal and juvenile thymus, involving thymocyte development in a beta-Klotho-independent manner. PMID:28336912
  8. During pregnancy, both systemic and cardiac-produced Fgf21 act on the heart, leading to the normal physiological cardiac changes that are associated with pregnancy. PMID:28472473
  9. our results demonstrated that FGF21 promotes cell cycle exit and enhances myogenic differentiation of C2C12 cells. This study provided new evidence that FGF21 promotes myogenic differentiation, which could be useful for better understanding the roles of FGF21 in myogenesis. PMID:29109955
  10. We will clarify the positive and negative signaling mechanisms which control the stress-related expression of FGF21 through the ISR pathway. Moreover, we will examine the role of FGF21 as an interorgan coordinator of survival functions in metabolic and stress disorders. We conclude that FGF21 can be viewed as a cell non-autonomous enhancer of longevity in mammals. PMID:28844867
  11. under nutrient-limiting conditions that stimulate ATF4 activity, TRIB3 is implicated in the regulation of metabolic adaptation by restraining the transcription of Fgf21. PMID:29378327
  12. alcohol-induced FGF21 expression is a hepatic adaptive response to lipid dysregulation. PMID:27498701
  13. the adipose-derived FGF21-CCL11 axis triggers cold-induced beiging and thermogenesis by coupling sympathetic nervous system to activation of type 2 immunity in subcutaneous white adipose tissue. PMID:28844880
  14. These results uncover a negative feedback loop in which CREBH regulates nonesterified fatty acid flux from adipose tissue to the liver via FGF21. PMID:27301791
  15. Chronic high-sucrose diet does not lead to obesity in mice. Data suggest that high-sucrose diet leads to up-regulation of Fgf21 expression in liver and brown adipose tissue plus high levels of Fgf21 in plasma which eventually lead to increased energy expenditure and, thus, does not cause obesity in this species. PMID:28886439
  16. plasma levels of Fgf21 reflect liver fat accumulation and dysregulation of metabolic pathways in the liver. PMID:27470139
  17. atheroprotective effect of brown adipose transplantation is BAT-specific and independent of lipid-lowering effect, accompanied by adrenergic receptor-mediated activation of the FGF-21-adiponectin axis. PMID:29496444
  18. the suppression of Nrf2 attenuates adipogenesis and decreases FGF21 expression through PPARgamma in 3T3-L1 cells. PMID:28131830
  19. these findings elucidate the involvement of abnormal FGF21 expression in early APAP-induced liver impairment. Interestingly, FGF21 may be a promising biomarker of APAP-exposed livers. PMID:28591702
  20. Reduced DNA methylation is associated with enhanced induction of hepatic FGF21 expression after PPARalpha activation, which may partly explain the attenuation of diet-induced obesity in adulthood. PMID:29434210
  21. These results suggest that FGF21 deficiency slow gastric emptying rate and indirectly influence initial alcohol metabolism in mice exposed to acute alcohol. Our findings provide additional information for understanding the gastrointestinal mechanism of alcoholic liver disease and other alcohol use disorders. PMID:29448103
  22. Serum fibroblast growth factor 21 (FGF21) levels positively correlate with the subcutaneous adipose tissue (SAT) area in insulin-sensitive obese mice. PMID:29348470
  23. Data (including data from studies in knockout mice) suggest that dietary manipulations that induce ketosis also lead to increased HPA axis tone; FGF21 knockout mice exhibit blunted HPA response to ketogenic diet relative to wild-type mice; thus, the hepatokine FGF21 appears to play important role in response to ketogenic diet. (HPA axis = hypothalamic-pituitary-adrenal axis) PMID:29077838
  24. These results suggest that berberine-induced activation of AMPK may contribute to hepatic FGF21 expression via NUR77. PMID:29247651
  25. our results demonstrate that Sp1 positively regulates the basal transcription of FGF21 in the liver and adipose tissue and contributes to the obesity-induced FGF21 upregulation in mouse adipose tissue and hepatic FGF21 upregulation in hepatocarcinogenesis. PMID:28466020
  26. FGF21 deletion aggravates aortic remodeling and cell death probably via exacerbation of aortic inflammation and oxidative stress in type 1 diabetes. PMID:27391008
  27. This study demonstrates that FGF21 action is necessary to achieve the full metabolic benefits of exercise during chronic HF feeding. PMID:27445299
  28. cholestasis could induce FGF21 expression in FXR dependent manner PMID:27003131
  29. FGF21 appears to act in a paracrine manner to increase glucose uptake under low insulin conditions, but it does not contribute to the resistance to diet-induced obesity. PMID:27184848
  30. FGF21 has a role in promoting remyelination in the central nervous system PMID:28825598
  31. Data suggest that expression of Fgf21 in liver responds acutely to dietary protein intake; low-protein high-carbohydrate diet induces Fgf21 expression; high-protein low-carbohydrate diet reduces Fgf21 expression; Fgf21 expression/secretion in cultured hepatocytes appears to be controlled by glucose but not amino acids. PMID:27574977
  32. These findings reveal a previously unappreciated anti-inflammatory role for FGF21 in adipose tissue, but do not support that FGF21 is necessary for exercise-mediated anti-inflammatory effects. PMID:28765264
  33. OPA1 mutant mice are resistant to age- and diet-induced weight gain and insulin resistance, by mechanisms that involve activation of endoplasmic reticulum stress and secretion of fibroblast growth factor 21 (FGF21) from skeletal muscle, resulting in increased metabolic rates and improved whole-body insulin sensitivity. PMID:28607005
  34. FGF21 is not critical for bone homeostasis or actions of PPARalpha and PPARgamma. PMID:27505721
  35. inhibitor of mTORC1 to control hepatic insulin action and maintain glucose homeostasis PMID:26926384
  36. the acute and chronic effects of FGF21 can be dissociated through adipose-dependent and -independent mechanisms. PMID:28380381
  37. pancreatic FGF21 is a digestive enzyme secretagogue. PMID:28089565
  38. These findings reveal an iNKT cell-FGF21 axis that defines a new immune-mediated pathway that could be targeted for glycemic control and weight regulation. PMID:27593966
  39. the metabolic outcomes associated with elevated FGF21 depend on the nutritional context, differing according to whether the animal is in a state of under- or overfeeding. PMID:27693377
  40. These findings indicate that FGF21 is crucial for the fenofibrate-mediated improvement of whole body glucose metabolism in obese mice via the amelioration of WAT dysfunctions. PMID:28404815
  41. These new findings reveal that the FGF21-betaKlotho-FGFR1 signaling axis plays roles in maintaining phospholipid homeostasis and the dynamic functions of the lipid droplet, whereas protecting against ER stress, and suggest a potential link of phospholipid biosynthesis, lipid droplet dynamics, ER stress, and energy homeostasis in adipose tissue coordinated by this signaling axis. PMID:27690692
  42. CYP2A5 protects against the development of alcoholic fatty liver disease, and the PPARalpha-FGF21 axis contributes to the protective effects of CYP2A5 on alcoholic fatty liver disease. PMID:28131861
  43. Heme-Regulated eIF2alpha Kinase Modulates Hepatic FGF21 and Is Activated by PPARbeta/delta Deficiency. Findings suggest that HRI is a potential target for regulating hepatic FGF21 levels. PMID:27486236
  44. FGF21 promotes myoblast differentiation and serves as a switch of molecular transformation from anaerobic myofibers to aerobic myofibers via the FGF21-SIRT1-AMPK-PGC1alpha axis. PMID:27966786
  45. FGF21-PXR signaling pathway may be involved in decreased hepatic CYP3A4 metabolic activity in Nonalcoholic fatty liver disease. PMID:27482056
  46. data show that AHR contributes to hepatic energy homeostasis, partly through the regulation of FGF21 expression and signaling. PMID:27226639
  47. this study shows that FGF21 exerts an anti-inflammatory effect mainly via enhancing Nrf2-mediated anti-oxidant capacity and suppressing NF-kappaB signaling pathway PMID:27276443
  48. FGF21 corrects multiple metabolic parameters on NAFLD in vitro and in vivo by inducing autophagy. PMID:27435856
  49. these data reveal a previously unidentified role for FGF21 on bile acid metabolism and may be relevant to understand the effects of FGF21 analogs in clinical studies. PMID:28041926
  50. These results suggest for the first time that FF prevents the development of diabetic nephropathy via up-regulating FGF21 and stimulating PI3K/Akt/GSK-3b/Fyn-mediated activation of the Nrf2 pathway. PMID:26849944

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Most abundantly expressed in the liver, also expressed in the thymus at lower levels. Expressed in skeletal muscle (at protein level). Secreted in plasma (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products