Home
Product
Protein
Recombinant Proteins
Recombinant Mouse Fibroblast growth factor 20 (Fgf20)

Recombinant Mouse Fibroblast growth factor 20 (Fgf20)

In Stock

Code: CSB-EP008626MO

Rate （N/A）
Review （0）
Citation （1）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$554

Quantity:

Express system: E.coli

Species: Mus musculus (Mouse)

Tag Info: Tag-Free

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Fgf20

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Fgf20

Uniprot NO.

Q9ESL9

Research Area

Cancer

Alternative Names

Fgf20Fibroblast growth factor 20; FGF-20

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-211aa

Target Protein Sequence

MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

23.6 kDa

Protein Length

Full Length

Tag Info

Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Tris-based buffer，50% glycerol

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

This Recombinant Mouse Fgf20 protein was made through genetic engineering. By putting the Fgf20 gene into the genetic material of E.coli cell, the E.coli could be used as factories or producers to make the desired Fgf20 protein for research uses. The expression region of this protein is at 1-211aa. No tag was used in the expression process. The purity is 85%+ determined by SDS-PAGE.

Fibroblast growth factor 20 (FGF20), a member of the FGF family, is a paracrine growth factor whose orthologs are highly conserved among vertebrates. Human FGF20 is highly similar to rat FGF20 and mouse FGF20 (nearly 95% amino acid identity). FGF20, expressed mainly in the brain, has been suggested to be a critical factor involved in brain development and neuronal homeostasis. Reports identified the therapeutic effects of FGF20 on CNS conditions, PD and Alzheimer's disease. According to a previous study, rhFGF20 protected against BBB disruption by suppressing the inflammatory response, an effect that might be mediated through inhibition of the JNK and NF-κB signaling pathways. aFGF has been reported to inhibit the activity of JNK and NFκB through TAK/TAB to exert anti-inflammatory effects, and FGF21 can inhibit the JNK/NFκB pathway. The positive roles of FGF20 in Parkinson’s disease (PD) imply that it may play a neuroprotective role in other CNS disorders.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Citations

Skeletal dysmorphology and mineralization defects in Fgf20 KO mice S Dlugosova,/,2024

Target Background

Function(From Uniprot)

Neurotrophic factor that regulates central nervous development and function.

Gene References into Functions

Data show that Fibroblast Growth Factors (FGF) 9 and 20 regulate the number of cochlear progenitors. PMID:25915623
fibroblast growth factor 20 (Fgf20) is expressed in hair placodes and is induced by and functions downstream from epithelial ectodysplasin (Eda)/Edar and Wnt/beta-Catenin signaling to initiate formation of the underlying dermal condensation PMID:23431057
We hypothesized that Fgf20 plays a role in specification, amplification, or maintenance of Sox2 expression in prosensory progenitors of the developing mammalian cochlea. PMID:22973011
Fgf20 is a major downstream effector of ectodysplasin and affects ectodysplasin-regulated characteristics of tooth morphogenesis, including the number, size and shape of teeth. PMID:22833125
The data suggested that, at a minimum, Fgf9/20 and Bmp7 organize the nephron progenitor niche. FGF signaling likely regulates multiple important steps in the niche, including survival, proliferation, and competence. PMID:22698282
Data indicate that the viability and hearing loss in Fgf20 knockout mice suggest that FGF20 may also be a deafness-associated gene in humans. PMID:22235191
expression of FGF20 in calvarial and limb development PMID:11900978
Fgf20 is expressed at the right time and place to mediate sensory cell specification and is the likely activator/ligand of fibroblast growth factor (FGF) receptor 1 during cochlear development. PMID:18524904