Recombinant Mouse Complement C3 (C3), partial

In Stock
Code: CSB-EP365507MO
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: N-terminal 6xHis-SUMO-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
C3
Uniprot NO.
Research Area
Others
Alternative Names
Complement C3; HSE-MSF; Complement C3 beta chain; C3-beta-c; C3bc; Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein; ASP; C3adesArg; Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3dg fragment; Complement C3g fragment; Complement C3d fragment; Complement C3f fragment; Complement C3c alpha' chain fragment 2
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1321-1663aa
Target Protein Sequence
SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.3kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description
Recombinant Mouse Complement C3 (C3) is a partial-length protein expressed with N-terminal 6xHis-SUMO-tagged in the E.coli. Its expression region corresponds to 1321-1663aa of mouse C3 protein. Its purity was determined by SDS-PAGE and reached up to 90% and presented a molecular mass band of 55.3kDa on the gel. This recombinant C3 protein may be used to synthesize antibodies against C3. C3 proteins in-stock are available.
Complement C3 (C3) plays a central role in the activation of complement system. Its activation by C3 convertase is required for both classical and alternative complement activation pathways. C3 mutations are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients. Diseases associated with C3 include Complement Component 3 Deficiency, Autosomal Recessive and Hemolytic Uremic Syndrome, Atypical 5.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

I ask for the concentration of the current lot CSB-EP365507MO? Would you have this information available that you could share?

A:
Very nice to receive your inquiry. The concentration of the current lot is 1mg/ml. The details are as below.
Code: CSB-EP365507MO
Name: Recombinant Mouse Complement C3(C3) ,partial
Expression Region: 1321-1663aa, partial
Tag Info: N-terminal 6xHis-SUMO-tag
Target Protein Sequence:

SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTES
MVVYGCPN


Lead Time: 3-5 working days
Q:

I would like to know the concentration of the following protein (CSB-EP365507MO):
http://www.cusabio.com/Recombinant-Protein/Recombinant-Mouse-Complement-C3C3-partial-307333.html
Could you provide it for us?

A:
Thanks for your inquiry.
Expression region: 1321-1663aa, C-terminal fragment; Complement C3c alpha' chain fragment 2
Tag information: N-terminal 6xHis-sumo-tag
Concentration: 1mg/ml.
Target protein sequence:

SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN

Target Background

Function(From Uniprot)
C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.; Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a chemoattractant for neutrophils. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. The short isoform has B-cell stimulatory activity.; Acts as a chemoattractant for neutrophils in chronic inflammation.; adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.
Gene References into Functions
  1. It has been shown that key proteins in the lectin arm of this pathway, MASP1, MASP2 and C3, are expressed in the developing cortex and that neuronal migration is impaired in knockout and knockdown mice. PMID:28462915
  2. Complement C3 role in the lung cancer progression. PMID:29118090
  3. Data report C3 as a novel myogenic factor secreted by undifferentiated preadipocyte that enhances myogenic differentiation of fetal progenitor cells and adult cells. The results show that complement C3 molecule internalizes myogenic and adipogenic precursor cells and then promotes their differentiation. PMID:28279023
  4. C3 deficiency can prolong MHC-II molecule mismatched skin allograft survival. PMID:27641978
  5. C3 role in the retinal epithelium and photoreceptor degeneration PMID:28348233
  6. These findings shed light on mechanisms of age-related retinal alterations by identifying C3 as a potential therapeutic target for retinal aging. PMID:28928904
  7. These findings suggest that C3 protects from early glaucomatous damage, a process that may involve EGFR signaling and other immune responses in the optic nerve head. PMID:28446616
  8. complement C3 or downstream complement activation fragments may play an important role in Abeta plaque pathology. PMID:28566429
  9. C5 and C5aR have critical roles in the development of C3 glomerulopathy. PMID:28139294
  10. Data show that months after irradiation (IR) complement component 3 (C3-/-) mice made fewer errors than WT mice in a reversal learning test indicating better learning capacity in C3-/- mice after IR. PMID:27029069
  11. Study show s the regulation of C3 Activation by the Alternative Complement Pathway in the Mouse Retina PMID:27564415
  12. Time-lapse video microscopy established the localization of the complement anaphylatoxin C3a and its receptor on enteric neural crest cells during their migration in the embryonic gut. C3a plays a role in regulating collective and directional cell migration, and in ganglia network organization during enteric nervous system ontogenesis. It regulates cell migration in a N-cadherin-dependent process. PMID:27041467
  13. nutrient sensing in the liver is coupled to release of C3 and potentially its metabolic and inflammatory functions. PMID:27735945
  14. Retinal C3 was expressed by microglia/macrophages located in the outer retina in AMD eyes. In rodent photo-oxidative damage, C3-expressing microglia/macrophages and complement activation were located in regions of lesion expansion in the outer retina over 2 months PMID:28605809
  15. Wild-type C57BL/6 mice with pristane-induced lupus developed a strong IFN signature, which was absent in immunoglobulin-deficient (muMT), C3(-/-) , and CD18(-/-) mice. In vivo phagocytosis of dead cells was impaired in C3-deficient mice. PMID:27274010
  16. Study found that cancer-cell-derived C3 activates the C3a receptor in the choroid plexus epithelium to disrupt the blood-cerebrospinal fluid (CSF) barrier. This effect allows plasma components, including amphiregulin, and other mitogens to enter the CSF and promote cancer cell growth. PMID:28283064
  17. We induced anti-myeloperoxidase vasculitis in mice and confirmed a role for complement activation by demonstrating protection in C3-deficient mice. PMID:27235854
  18. These data indicated that alpha7-nAChR caused the inhibition of ASPinduced activation of p38 kinase and NFkappa B to inhibit the production of MCP1 and keratinocytederived chemokine. PMID:27572255
  19. These results suggest that GAS utilizes diverse mechanisms to degrade C3b and thus to protect bacterial cells from the complement response of the host. PMID:26945067
  20. This study provideed the evidence that C3a plays a critical role in cerebral endothelial activation and leukocyte recruitment during inflammation in the brain. PMID:26822321
  21. Demonstrate that cardiac Sirt1 plays an essential role in caloritc restriction-induced cardioprotection against myocardial I/R injury by suppressing cardiac C3 expression. PMID:26873964
  22. The roles of C3, CfB, and C3a receptor in the severity of S. aureus induced septic arthritis are reported. PMID:26787717
  23. Study shows that C3a is locally produced by -retinal pigment epithelial cells suggesting a key role in early macular degenerations pathogenesis. PMID:26199322
  24. Complement C3 activation occurs following intramuscular islet transplantation, but it does not seem to affect the graft function. PMID:26900812
  25. Studied whether increased levels of complement in HD brains contributed to disease progression in the R6/2 mouse model of HD. Found C3 deficiency does not alter HD progression in the R6/2 mouse model. PMID:23097680
  26. Identify complement 5a as the major C3 activation product that was involved in macrophage polarization and DOCA-salt-induced vascular injury. PMID:25573852
  27. our findings define the mechanism of receptor crosstalk between CR3 and Dectin-1 and demonstrate the importance of their collaboration in host defense against fungal infection. PMID:26132276
  28. Carboxypeptidase B2 deficiency reveals that complement C3a limits infection in a murine polymicrobial sepsis model. PMID:25851247
  29. Complement component 3 is up-regulated via non-canonical TGF-beta signaling in the retinal pigment epithelium PMID:25802332
  30. Data indicate that for all three pathways there was a strong correlation between the amount of Ccomplement C3 (C3) fragments and the reduction in functional complement activity. PMID:25733354
  31. Therapeutic efficacy of radiotherapy depends on C3a and C5a. PMID:25888260
  32. C3 secreted from mycoplasma-infected Mesenchymal stem cells (MSCs) has an important role in the immunomodulatory functions of MSCs. PMID:24763049
  33. Data indicate that absence of complement C3, complement C5 and Fc receptor subunit gamma (FcRgamma) does not impact autoantibody production in K/BxN mice. PMID:23237573
  34. These results suggest that osteoclast-derived C3a functions in the relay from bone resorption to formation and may be a candidate for a coupling factor. PMID:24470120
  35. Coagulation cascades, by generating thrombin and plasmin, respectively, provide C5 convertase activity, explaining why mobilization of hematopoietic stem cells in C3-deficient mice. PMID:24667943
  36. These results provide new insights into the role of systemic C3 in regulating contraction following intracellular bacterial infection and may help to develop vaccines that are more effective. PMID:25187659
  37. a role for outside-in iC3b-CD11b signals in limiting intrinsic organ inflammation PMID:24632830
  38. have identified Complement C3 as a candidate plasma biomarker for measuring disease state in neuroblastoma PMID:24200836
  39. A previously unknown function of C3a promotes protection to both myeloid and lymphoid cells against Listeria monocytogenes-induced apoptosis. PMID:24981453
  40. Genetic and intervention studies implicating complement C3 as a major target for the treatment of periodontitis. PMID:24808362
  41. Loss of dopaminergic neurons was rescued by complement C3-deficient mice. PMID:24948809
  42. Complement protein C3 exacerbates prion disease in a mouse model of chronic wasting disease. PMID:24038599
  43. Complement C3 and C5 deficiency affects bone fracture healing. PMID:24260573
  44. Radiation combined injury-induced alterations of corticosterone, CRP, C3, IgM, and PGE2 cause homeostatic imbalance and may contribute to reduced survival. PMID:24175013
  45. Data indicate that co-deficiency of factor H (FH) and MASP-1/MASP-3 did not ameliorate either the plasma Complement C3 (C3) activation or glomerular C3 accumulation in FH-deficient mice. PMID:24279761
  46. The results of this study suggested that C3 plays a role in the regulation of the number and function of glutamatergic synapses in the hippocampus and exerts negative effects on hippocampus-dependent cognitive performance. PMID:24378428
  47. C3 induces epithelial-to-mesenchymal transition and may be a primary factor to activate the renal renin-angiotensin systems to induce hypertension. PMID:23926185
  48. Data indicate complement C3 deposition on peanut extract (PE) was abolished in immunoglobulin- and C4-deficient sera. PMID:23182714
  49. ALI in H5N1-infected mice was caused by excessive complement activation, as demonstrated by deposition of C3, C5b-9, and MBL-C in lung tissue, and by up-regulation of MBL-associated serine protease-2 and the complement receptors C3aR and C5aR. PMID:23526211
  50. in vitro results suggest various metabolic hormones and inflammatory factors can affect acylation stimulating protein (ASP) production and that ASP could constitute a new link between adipocytes and macrophage PMID:23430572

Show More

Hide All

Subcellular Location
Secreted.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products