Recombinant Mouse Chitinase-3-like protein 1 (Chi3l1)

Product Details

Abbreviation
Chi3l1
Purity
>85% (SDS-PAGE)
Target Names
Chi3l1
Uniprot NO.
Alternative Names
Chi3l1; Brp39; Chil1; Chitinase-3-like protein 1; BRP39 protein; Breast regression protein 39; Cartilage glycoprotein 39; CGP-39; GP-39
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
30-389
Target Protein Sequence
YKLVCYFTS WSQYREGVGS FLPDAIQPFL CTHIIYSFAN ISSDNMLSTW EWNDESNYDK LNKLKTRNTN LKTLLSVGGW KFGEKRFSEI ASNTERRTAF VRSVAPFLRS YGFDGLDLAW LYPRLRDKQY FSTLIKELNA EFTKEVQPGR EKLLLSAALS AGKVAIDTGY DIAQIAQHLD FINLMTYDFH GVWRQITGHH SPLFQGQKDT RFDRYSNVNY AVQYMIRLGA QASKLLMGIP TFGKSFTLAS SENQLGAPIS GEGLPGRFTK EAGTLAYYEI CDFLKGAEVH RLSNEKVPFA TKGNQWVGYE DKESVKNKVG FLKEKKLAGA MVWALDLDDF QGTCQPKEFF PLTNAIKDAL A
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

I have plan to buy protein (which is EP002683 and EP20246).
let me know the information.
Thesse product is mature protein.
Dose in contain signal peptide ?
Your protien contain only mature sequcnce of protein?
Thanks you so much.

A:
Thanks for your inquiry.
1. Recombinant Mouse Biglycan(Bgn)
CSB-EP002683MO >> E.coli
Lead time:
Expression Region: 38-369aa; Full length of the mature protein.
Tag information:N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein Sequence:(Not include the tag sequence and signal peptide sequence)

DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK


2.Recombinant Mouse Chitinase-3-like protein 1(Chi3l1)
CSB-EP720246MO >> E.coli
Lead time:
Expression Region: 30-389aa; Full length of the mature protein.
Tag information:N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target protein Sequence:(Not include the tag sequence and signal peptide sequence)

YKLVCYFTSWSQYREGVGSFLPDAIQPFLCTHIIYSFANISSDNMLSTWEWNDESNYDKLNKLKTRNTNLKTLLSVGGWKFGEKRFSEIASNTERRTAFVRSVAPFLRSYGFDGLDLAWLYPRLRDKQYFSTLIKELNAEFTKEVQPGREKLLLSAALSAGKVAIDTGYDIAQIAQHLDFINLMTYDFHGVWRQITGHHSPLFQGQKDTRFDRYSNVNYAVQYMIRLGAQASKLLMGIPTFGKSFTLASSENQLGAPISGEGLPGRFTKEAGTLAYYEICDFLKGAEVHRLSNEKVPFATKGNQWVGYEDKESVKNKVGFLKEKKLAGAMVWALDLDDFQGTCQPKEFFPLTNAIKDALA


Yes, for these two proteins, what we provide is the full length of the mature protein, not include the signal peptide,
In general, the strong hydrophobicity of the signal peptide will increase the difficulty of expression.
At the same time, the signal peptide will be cut off by the signal peptidase in the process of secretion expression.
The mature protein does not contain the signal peptide, and the functions for most of the protein are realized through the mature protein.
PS: If you need to express the proteins with the full sequence including the signal peptide, we can also try to express them for you, but the prices will be higher.

Target Background

Function(From Uniprot)
Carbohydrate-binding lectin with a preference for chitin. Has no chitinase activity. May play a role in tissue remodeling and in the capacity of cells to respond to and cope with changes in their environment. Plays a role in T-helper cell type 2 (Th2) inflammatory response and IL-13-induced inflammation, regulating allergen sensitization, inflammatory cell apoptosis, dendritic cell accumulation and M2 macrophage differentiation. Facilitates invasion of pathogenic enteric bacteria into colonic mucosa and lymphoid organs. Mediates activation of AKT1 signaling pathway and subsequent IL8 production in colonic epithelial cells. Regulates antibacterial responses in lung by contributing to macrophage bacterial killing, controlling bacterial dissemination and augmenting host tolerance. Also regulates hyperoxia-induced injury, inflammation and epithelial apoptosis in lung.
Gene References into Functions
  1. Chi3l1 is a regulator of Th1 and CTL which could be a therapeutic target to enhance anti-tumor immunity. PMID:29403003
  2. Nrf2/Keap1 system regulates VSMC apoptosis during neointimal formation, thereby inhibiting neointimal hyperplasia after a vascular injury. PMID:27198666
  3. Knockdown of Chi3l1 in the arterial endothelium suppressed the development of atherosclerosis in amyloid precursor protein transgenic mice. PMID:29344304
  4. CHI3L1 may be a previously unrecognized biomarker for diagnosing Gaucher Diseases (GD) and for evaluating the therapeutic effects of new GD drug. PMID:29396296
  5. CHI3L1 deficiency in donor splenocytes dramatically increased the severity of aGVHD through enhancing Tfh cell differentiation PMID:28656528
  6. miR-24 serves as a molecular regulator in S. aureus-induced macrophage polarization through targeting of CHI3L1 and regulation of the MAPK pathway PMID:28303416
  7. The mouse model was used to validate the function of CHI3L1 in cancer metastasis in vivo PMID:28143526
  8. CHI3L1-mediated cell proliferation/survival involves partial downregulation of the pro-apoptotic S100A9 protein that is highly expressed during the acute phase of colitis, by binding to the S100A9 receptor, RAGE (Receptor for Advanced Glycation End products). PMID:26431492
  9. IL-18 is a potent stimulator of Chi3l1 and that Chi3l1 is an important mediator of IL-18-induced inflammatory, fibrotic, alveolar remodeling, and cytotoxic responses. PMID:25955511
  10. CHI3L1 is induced during fungal infection, and it regulated antifungal innate immune responses in the cornea. PMID:26238714
  11. Astrocytic expression of chitinase 3-like protein 1 limits the extent of both astrocytic and microglial/macrophage facets of neuroinflammation. PMID:25377763
  12. Results do not support a role of BRP-39 in the pathogenesis of experimental autoimmune encephalitis. PMID:26079949
  13. CHI3L1 was increased in plasma and brain tissue in experimental cerebral malaria, but targeted Chi3l1 deletion did not alter cytokine production or survival in this model. PMID:25047113
  14. mechanism of BRP-39 in bleomycin-induced pulmonary fibrosis PMID:24659093
  15. Sem7a and its receptors regulate Chi3l1 in pulmonary melanoma metastasis PMID:25511377
  16. Data show that IL-1-induced transcriptin factor RelB/NF-kappa B p50 Subunit complex formation was further promoted by oncostatin M and that these complexes directly bound to the secreted protein cartilage glycoprotein 39 (YKL-40) promoter. PMID:25681350
  17. These results indicate that catalytically inactive BRP-39 and Ym1 are constitutive genes in normal mouse lung. PMID:25294623
  18. BRP-39 is involved in repressing the M1 proinflammatory phenotype in hyperoxia, thereby deactivating inflammatory responses in macrophages and preventing neonatal lung injury. PMID:24347826
  19. Chi3l1 binds to IL-13Ralpha2, stimulates MAPK, Akt/PKB, Wnt signaling and regulates melanoma metastasis. PMID:23972995
  20. Stat3 downstream gene product chitinase 3-like 1 is elevated in lung cancer PMID:23613996
  21. We identified the macrophage-secreted chitinase-like protein Brp-39 as a critical component of this reparative response that serves to limit tubular cell apoptotic death via activation of Akt, improving animal survival after kidney ischemia/reperfusion. PMID:23291472
  22. BRP-39-deficient mice demonstrate the importance of BRP-39 in modulating the severity of clinical experimental autoimmune encephalomyelitis and central nervous system neuroinflammation. PMID:23041842
  23. Chitinase 3-like-1 is induced by Streptococcus pneumoniae and plays central roles in promoting bacterial clearance and mediating host tolerance. PMID:22817986
  24. CHI3L1 up-regulates pro-inflammatory mediators, C-chemokine ligand 2, chemokine CX motif ligand 2 and matrix metalloproteinase-9 all of which contribute to tumor growth and metastasis; study shows that CHI3L1 plays a role in tumor progression PMID:21866546
  25. YKL-40-mediated inhibition of cell differentiation and polarization in the presence of lactogenic hormones may represent its important function during mammary tissue involution. PMID:21991364
  26. YKL-40/BRP-39 levels are increased in human and murine CF airway fluids PMID:21949714
  27. The carbohydrate-binding region of CHI3L1 is critical in activating Akt signaling in colon epithelial cells, and the activation may be associated with the development of chronic colitis. PMID:21546314
  28. breast regression protein-39 has a role in the pathogenesis of cigarette smoke-induced inflammation and emphysema PMID:20656949
  29. BRP-39 is functionally important in house dust mite-induced inflammation. BRP-39 is a biomarker of cigarette smoke induced inflammation which is the byproduct of an IL-1 inflammatory pathway. PMID:21473774
  30. pathogenic role in colitis, presumably by enhancing the adhesion and invasion of bacteria on/into colonic epithelial cells. PMID:16472595
  31. Cloning, expression, characterization and crystallization of BRP39, a signalling glycoprotein expressed during mammary gland apoptosis PMID:19041398
  32. BRP-39 deficient mice show diminished antigen-induced Th2 cell responses, rescued by YKL-40 administration. PMID:19414556

Show More

Hide All

Subcellular Location
Secreted, extracellular space. Cytoplasm. Endoplasmic reticulum. Note=Detected in bronchoalveolar lavage (BAL) fluids. Localizes mainly to endoplasmic reticulum when overexpressed in cells, with some protein also detected throughout the cytoplasm.
Protein Families
Glycosyl hydrolase 18 family
Tissue Specificity
Detected in lung in pulmonary macrophages and alveolar type 2 cells and in bronchoalveolar lavage (BAL) fluids. Expressed in mammary tumor cells (at protein level). Expressed in lung. Not detected in non-inflammatory colon.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1