Recombinant Mouse Caspase-12 (Casp12), partial

Code: CSB-EP004545MO

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$388

Quantity:

Express system: E.coli

Species: Mus musculus (Mouse)

Tag Info: N-terminal 6xHis-B2M-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Casp12

Uniprot NO.

O08736

Research Area

Cancer

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-92aa

Target Protein Sequence

MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.3 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-B2M-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Involved in the activation cascade of caspases responsible for apoptosis execution.

Gene References into Functions

mice ablated for caspase-12 develop spontaneous obesity and insulin resistance. PMID:26582949
Caspase-12 plays a pivotal role in CCl4-induced hepatic apoptosis through the activation of the downstream effector caspase-3 directly and/or indirectly via caspase-9 activation. PMID:25561786
We validated caspase-12 as a therapeutic target, ablation of which significantly protects T17M photoreceptors from deterioration. PMID:26207309
Findings an increase in multiple unfolded protein response pathways in muscles of the dystrophin-deficient mdx mouse, the model for Duchenne muscular dystrophy. PMID:24879640
Tauroursodeoxycholic acid intervention down-regulated GRP78 and CHOP expression and Caspase 12 activation. PMID:22212133
Findings indicate that although caspase-12 deficiency results in enhanced pro-inflammatory and immunoregulatory cytokine levels in sera during P. yoelii 17XL infection, these responses are not essential for protection against lethal malaria infection. PMID:21086719
caspase-12 competed with NEMO for association with IkappaB kinase-alpha/beta, effectively preventing the formation of the IkappaB kinase complex and inhibiting downstream transcriptional activation by NF-kappaB. PMID:20876354
Caspase-12 was required for an effective antiviral immune response, especially for the production of type I interferons through the regulation of TRIM25-mediated ubiquitination of RIG-I. . PMID:20818395
Matrix metalloproteinase-3 is increased and participates in neuronal apoptotic signaling downstream of caspase-12 during endoplasmic reticulum stress PMID:20368330
Reactive oxygen species promote caspase-12 expression and tubular apoptosis in diabetic nephropathy. PMID:20299359
enhanced repair response of Casp12(-/-) mice rendered them more susceptible to colorectal cancer induced by azoxymethane (AOM)+ dextran sulfate sodium. PMID:20226691
role of caspase-12-dependent pathway in apoptosis induction by manganese(II) PMID:11964391
caspase-12 was activated by poly(Q)(72) aggregates via a pathway independent of caspase-8 and caspase-3 activation, and caspase-12 activation was closely associated with poly(Q) aggregate-mediated cell death PMID:12045204
procaspase-9 is a substrate of caspase-12 and ER stress triggers a specific cascade involving caspase-12, -9, and -3 in a cytochrome c-independent manner. PMID:12097332
Caspase-12 seems to be involved in neuronal death induced by ischemia/reperfusion. PMID:12699784
Pathways involving this enzyme are involved in a neurodegenerative disease in vivo, and thus offer novel potential targets for the treatment of prion disorders. PMID:14532116
caspase-12 expression in caspase-12 is regulated by NF-E2 and participates in the development of fully functional signaling pathways linking some G-protein-coupled receptors to alphaIIbbeta3 activation. PMID:15059849
both caspases and calpains are involved in 661W photoreceptor apoptosis PMID:15210718
The results indicate that oxidative and ER induced stress causing caspase-12 activation are involved in neuronal death and disease progression in ALS. PMID:15313203
cloning of promoter PMID:15701691
caspase-12 and caspase-4 are not required for the induction of ER stress-induced apoptosis and that caspase-4-like activity is not always associated with an initiating event. PMID:15975932
Ribozyme 138 prepared in vitro can site specific cleave mouse caspase-12 mRNA with an excellent efficiency. PMID:15996037
Data show that overexpression of X-linked Inhibitor of Apoptosis Protein (XIAP)inhibits caspase-12 cleavage and reduces calpain activity in amyotrophic lateral sclerosis mice. PMID:16566922
provides compelling genetic evidence for calpain's role in caspase-12 activation at the endoplasmic reticulum (ER), and reveals a novel role for the ubiquitous calpains in ER-stress induced apoptosis and JNK activation PMID:16597616
In mice, caspase-12 deficiency confers resistance to sepsis and its presence exerts a dominant-negative suppressive effect on caspase-1, resulting in enhanced vulnerability to bacterial infection and septic mortality PMID:16625199
apoptosis-inducing factor plays the major role in this apoptotic event, whereas caspase-12 has a reinforcing effect PMID:17088543
Data show that caspase-12 can compensate for lack of caspase-2 and caspase-3 in female germ cells. PMID:17245644
In hippocampal neuroblasts, Ca(++) mobilization from ER and caspase-12 activation are components of the molecular pathway that leads to apoptosis triggered by serum deprivation and may constitute an amplifying loop of the mitochondrial pathway. PMID:17399692
Nod activation and resulting antimicrobial peptide production constitute an early innate defense mechanism, and caspase-12 inhibits this mucosal antimicrobial response. PMID:18329614
caspase-12 is not necessary for mediating the neurotoxic effects of prion protein misfolding. PMID:19164919