Abbreviation
Recombinant Mouse Cd40lg protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Cd40(CSB-MP004936MO1) at 2 μg/mL can bind Mouse Cd40lg.The EC50 is 5.121-6.085 ng/mL.
Alternative Names
CD40 ligand;CD40-L; T-cell antigen Gp39TNF-related activation protein (TRAP); Tumor necrosis factor ligand superfamily member 5; CD154; Cd40lg; Cd40l, Tnfsf5
Species
Mus musculus (Mouse)
Expression Region
112-260aa
Target Protein Sequence
MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal mFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Cd40(CSB-MP004936MO1) at 2 μg/ml can bind Mouse Cd40lg.The EC50 is 5.121-6.085 ng/mL.
Description
CD40 ligand plays a central role in T cell–B cell crosstalk, driving B cell activation, immunoglobulin class switching, and germinal center formation, making it a key target in cancer immunotherapy and autoimmune disease models. This mammalian-expressed protein, spanning residues 112–260 and carrying an N-terminal mFc1 tag, demonstrates robust receptor engagement with an EC50 of 5.1–6.1 ng/mL in functional ELISA against immobilized mouse CD40, confirming its capacity to trigger downstream signaling events. The low picomolar binding potency supports its use in B cell proliferation and activation assays, NF-κB and MAPK pathway studies, and in vivo tumor immunology models where CD40–CD40L interactions modulate dendritic cell maturation and anti-tumor immunity. With endotoxin levels below 1.0 EU/μg and purity exceeding 95%, this preparation meets the quality thresholds commonly required for primary immune cell cultures and antibody development workflows where LPS contamination would confound cytokine-specific responses.