MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. Involved in the recruitment of CPC to centromeres during early mitosis via association with histone H3 phosphorylated at 'Thr-3' (H3pT3) during mitosis. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7. Essential for the maintenance of mitochondrial integrity and function.
Gene References into Functions
The present results indicated that PPARgamma may serve a protective role on bEnd.3 cells and that BIRC5 may be a downstream target of PPARgamma regulation during cerebral ischemia.PMID:29039513
While induced by exposure to reactive oxygen species generating stresses, the ultimate expression of changes in radiation response is dependent upon the bi-functionality of the tumor associated protein survivin and its intracellular translocation.PMID:27427516
HDL-associated sphingosine 1-phosphate inhibits macrophage apoptosis by stimulating STAT3 activity and survivin expression.PMID:28038379
Survivin also attenuates DNA damage related to PARP activation and inhibits TNFalpha-induced lipolysis, suggesting that Survivin may facilitate adipocyte maintenance in response to inflammatory stimuli.PMID:28055005
The study assigns a new meiotic function to Cullin9 and reveals that it prevents mouse eggs from aneuploidy by regulating microtubule dynamics via survivin.PMID:27678504
this study shows that that sorafenib promotes the survival of bone marrow cells by up-regulating survivinPMID:27440860
Survivin was regulated by TGF-beta and was found to be highly expressed during mucosal healing following intestinal inflammationPMID:27715398
SurvivinT34A combined with arsenic trioxide induces a loss of mitochondria membrane potentialPMID:27748945
Survivin is a key regulator of gut tissue integrity by regulating epithelial homeostasis in the stem cell niche.PMID:26832409
TGFbetaRI inhibition in an injured adult heart could both stimulate the autocrine/paracrine activity of survivin and inhibit Wnt in CPCs to mediate cardioprotection and improve cardiac function.PMID:26418219
Survivin is a key gene for regulating squamous cell carcinoma (SCC) cancer stem cell formation and cancer SCC development.PMID:26771605
In colorectal cancer mice with downregulated expression of survivin, there were higher numbers of apoptotic cells and decreased expression levels of bcl2 and ki67.PMID:26722528
survivin is essential for B cell division but does not affect survival of naive B cells. Survival of proliferating B cells may be impacted indirectly by survivin deficiency because of increased genotoxic stress caused by failed chromosomal segregation.PMID:26810226
Survivin directly participates in PRL-mediated beta cell proliferation via Akt, STAT5-PIM and ERK signalling pathways during pregnancyPMID:26099856
Studied competitive inhibition of survivin using a cell-permeable recombinant protein induces cancer-specific apoptosis in colon cancer model.PMID:25678789
Results suggest a role for survivin in regulating adult neural precursor activity and inhibiting apoptosis or programmed cell death in the dentate gyrus following brain injuryPMID:25987205
NR4A1 protects pancreatic beta-cells against endoplasmic reticulum stress-mediated apoptosis by up-regulating Survivin expression and down-regulating CHOP expression.PMID:26157144
Studies indicate the importance of survivin in Sonic hedgehog (SHH)-driven medulloblastoma (MB).PMID:25241898
the Skp1.Cul1.F-box protein complex subunit Fbxl7 modulates mitochondrial function by controlling the cellular abundance of survivinPMID:25778398
Both HIF1-alpha and survivin are involved in the retinal neovascularization in oxygen-induced retinopathy.PMID:25400763
survivin-mediated radio-adaptive response is dependent upon the ability of cells to activate NFkappaBPMID:25763931
These findings provide evidence for the existance of a posititve feedback loop connecting survivin expression in tumor cells to PI3K/Akt enhanced beta-catenin-Tcf/Lef-dependent transcription followed by secretion of VEGF and angiogenesis.PMID:25204429
Survivin has an important role in regulating folliculogenesis and oogenesis in the adult mouse ovary.PMID:24675472
Survivin partially regulates HSC function by modulating the Evi-1 transcription factor and its downstream targetsPMID:24903482
The study shows that the inhibition of survivin is sufficient to reduce joint inflammation and bone damage in preclinical models of arthritisPMID:25381389
Survivin haploinsufficiency in syngeneic grafts was associated with Ischemia/reperfusion tissue injury, which triggered inflammation eventually resulting in graft loss.PMID:24731002
UHRF1 is strongly up-regulated during liver regeneration independently of BIRC5.PMID:24818710
Findings support the importance of adhesion molecules (VE-cadherin and CD31), survivin, and Ajuba in modulating the Hippo pathway, which regulates, in part, proliferation and survival in hemangioendotheliomas.PMID:25266662
Survivin may be an essential mediator of cyto-protection in podocytes injury.PMID:24747598
The survivin cascade in neural progenitor cells plays a role in anti-apoptosis.PMID:24022164
Data suggest that toll-like receptor 3 (TLR3), phosphatidylinositol 3-kinase (PI3K), survivin, Fas ligand (FasL), and CD95 (Fas) genes are involved in the development of cervical cancer.PMID:25106857
A 3M-CUL9-survivin pathway is implicated in maintaining microtubule and genome integrity, normal development, and tumor suppression.PMID:24793696
Data indicate that loss of survivin in conditional Pten deletion mouse model delays prostate tumor progression.PMID:23936028
The present studies aim to examine whether and how cilia function (Pkd1 or Pkd2) and structure (Tg737) play a role in cystic kidney and aneurysm through survivin downregulation.PMID:24235270
Increased expression of survivin correlates with the proliferation of neural stem cells in the DG of the hippocampus soon after traumatic brain injury.PMID:23900556
STAT3 phosphorylation and subsequent upregulation of survivin expression mediated by Notch-2 signaling in renal proximal tubule epithelial cells aid in the functional and structural recovery of the kidney from acute kidney injury.PMID:23949800
sticky siRNAs against survivin and cyclin B1 efficiently blocks growth of established subcutaneaous B16-F10 tumors as well as formation and dissemination of melanoma lung metastases.PMID:23835136
Data suggest survivin is a key mediator of cytoprotection in acute lung injury (as seen in antineoplastic-induced pulmonary fibrosis); survivin appears to act at epithelial/mucosal cell level; survivin action depends partly on apoptosis inhibition.PMID:23979427
Data from Pak1 knockout mice and RNA interference in cells suggest Pak1 has role in regulation of survivin ubiquitination/stability in beta-cells; impaired proliferation of beta-cells induced by loss of PAK1 is restored by overexpression of survivin.PMID:23514967
survivin inhibition/down-regulation with flavopiridol or specific shRNAs increased the apoptotic response of old fibroblasts to various genotoxic agentsPMID:22252435
These results suggest that OX40 costimulation crucially engages survivin during antigen-mediated Th2 responsesPMID:23616302
Thimerosal induces S phase arrest and finally causes apoptosis via inhibition of PI3K/Akt/survivin signaling.PMID:23145070
vaccination with recombinant Fowlpox expressing survivin improves T-cell responses against aggressive Malignant mesothelioma tumors and may form the basis for promising clinical applications.PMID:23335100
Our data support a function of survivin in hippocampal synaptic plasticity and learning and underline the importance of adult brain neurogenesis for proper operation of the hippocampal tri-synaptic circuit and the physiological functions that depend on itPMID:23123921
This study identified a novel role for survivin in erythroblast enucleation through previously unknown protein partners.PMID:22491741
overexpression of Bmi1 induces repressive epigenetic regulation of the promoter of Survivin, a well-characterized antiapoptotic protein.PMID:23132836
prepared two mutant forms of the PhSurv-PhTERT tandem with two or four Sp1 sites removed from the distal "long" PhSurv promoterPMID:23056318
Survivin prevents apoptosis by binding to caspase-3 in astrocytes infected with the BeAn strain of Theiler's murine encephalomyelitis virus.PMID:22638909
these data suggest a potentially novel role for survivin in functionally promoting astrocytic proliferation after intracerebral hemorrhagePMID:22862734
Survivin is a dual regulator of lens epithelial cell proliferation and lens fiber cell differentiation.PMID:23213276