Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial

Code: CSB-MP002207MO
Size:
20ug
20ug100ug1mg
US$190
Quantity:
Express system: Mammalian cell
Species: Mus musculus (Mouse)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Asgr1 protein, partial
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Asgr1
Uniprot NO.
Research Area
Others
Alternative Names
ASGP-R 1;ASGPR 1;Hepatic lectin 1;HL-1;mHL-1
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
61-284aa
Target Protein Sequence
QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
Gene References into Functions
  1. the key roles of the ManR and ASGR in controlling circulating levels of numerous glycoproteins critical for regulating reproductive hormones and blood coagulation. PMID:27405760
  2. Mice lacking the hepatocyte asialoglycoprotein receptor are more susceptible to the induction of T cell-mediated hepatitis suggesting a potentially significant role of the ASGPR in the homeostatic regulation of T cells in the liver. PMID:23538026
  3. found that the asialoglycoprotein receptor (ASGPR) is involved in hepatocyte recognition of cells predestined for killing, including activated autologous T lymphocytes PMID:21656538
  4. Asialoglycoprotein receptor 1 is a novel important factor that responds to endogenous lectins in the tumor microenvironment to promote metastasis by activating the epidermal growth factor receptor-extracellular signal-regulated kinase pathway. PMID:21868757
  5. Asialoglycoprotein receptor functions to help regulate the concentration of glycoproteins bearing sialic acid alpha 2,6GalNAc in the blood. PMID:16286643
  6. ERManI is required for trimming to Man(5-6)GlcNAc(2) and for endoplasmic reticulum associated degradation in cells in vivo. PMID:18003979
  7. The Ashwell receptor is composed of type 2 transmembrane glycoproteins termed Asgr1 and Asgr2. Both are predominantly expressed in the liver. PMID:18488037
  8. Proper ASGP receptor function protects against carbon tetrachloride-induced liver damage in a knockout mouse model lacking functional ASGP receptor. PMID:19185565

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed exclusively in hepatic parenchymal cells.
Database Links

UNIGENE: Mm.6559

KEGG: mmu:11889

STRING: 10090.ENSMUSP00000018699

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products