Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial

Code: CSB-MP013104MO1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$660
Quantity:
Express system: Mammalian cell
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Lrpap1
Uniprot NO.
Research Area
Cardiovascular
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
248-360aa
Target Protein Sequence
GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
18-28 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway.
Gene References into Functions
  1. RAP deficiency attenuated atherosclerosis without influencing abdominal aortic aneurysms in hypercholesterolemic mice infused with angiotensin II. PMID:22153700
  2. Findings reveal that RAP is a novel Abeta-binding protein that promotes cellular internalization of Abeta. PMID:19826010
  3. In RAP-deficient mice megalin expression was strongly reduced and restricted to a subapical localization and NaP(i)-IIa protein distribution and abundance in the kidney was not altered. PMID:12748857
  4. the His-sRAP-induced acceleration of megalin-mediated endocytosis causes phosphaturia via altered subcellular distribution of NaPi-II [39-kD receptor-associated protein (RAP)] PMID:15976002
  5. Results suggest that receptor-associated protein is required for the establishment of thyroglobulin reservoirs, but its absence does not affect hormone secretion. PMID:16306127
  6. RAP is expressed by thyrocytes in a TSH-dependent manner, both in cultured thyroid cells and in vivo PMID:17123336
  7. Disruption of the RAP gene determines not only thyroid abnormalities, but also a severe defect of megalin expression and function in the kidney. PMID:18296906
  8. Receptor-associated protein (RAP) plays a central role in modulating Abeta deposition in APP/PS1 transgenic mice PMID:18776935

Show More

Hide All

Subcellular Location
Rough endoplasmic reticulum lumen. Endoplasmic reticulum-Golgi intermediate compartment lumen. Golgi apparatus, cis-Golgi network. Golgi apparatus lumen. Endosome lumen. Cell surface.
Protein Families
Alpha-2-MRAP family
Tissue Specificity
Highly expressed in PYS-2 parietal endoderm cells and in the kidney. The RNA level increased about 10-fold during differentiation of F9 embryonal carcinoma cells to parietal endoderm cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products